BDBM239970 US9403801, 35

SMILES Cn1cc(Nc2ncc(Cl)c(NC3CC4CN(CC(F)(F)F)CC4C3)n2)cn1

InChI Key InChIKey=OUQLXOHGWYNDKX-UHFFFAOYSA-N

Data  2 IC50

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 2 hits for monomerid = 239970   

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239970(US9403801, 35)
Affinity DataIC50: 2nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239970(US9403801, 35)
Affinity DataIC50: 8nMpH: 7.0 T: 2°CAssay Description:JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/31/2017
Entry Details
US Patent