BDBM50043386 CHEMBL3355073

SMILES C[C@@H]1Cn2ncc(C3CCN(CC3)S(C)(=O)=O)c2CN1c1ccnc2[nH]ccc12

InChI Key InChIKey=RUBCMYKDFDSVRG-UHFFFAOYSA-N

Data  6 IC50

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 6 hits for monomerid = 50043386   

TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043386BDBM50043386(CHEMBL3355073)
Affinity DataIC50: 1nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043386BDBM50043386(CHEMBL3355073)
Affinity DataIC50: 160nMAssay Description:Inhibition of CHK1 in HeLa S3 cells assessed as inhibition of phosphorylation at ser345 by AlphaScreen SureFire CHK1 (p-Ser345) assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetSerine/threonine-protein kinase mTOR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043386BDBM50043386(CHEMBL3355073)
Affinity DataIC50: 2.30E+3nMAssay Description:Inhibition of mTOR (unknown origin) by alphascreen SureFire p70 S6K (p-Thr389) assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetDNA-dependent protein kinase catalytic subunit(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043386BDBM50043386(CHEMBL3355073)
Affinity DataIC50: 6.50E+3nMAssay Description:Inhibition of DNA-PK (unknown origin) using GGGGMEEPQSDPSVEPPLSQETFSDLWKLLPE peptide substrate by alphascreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetSerine-protein kinase ATM(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043386BDBM50043386(CHEMBL3355073)
Affinity DataIC50: 1.40E+4nMAssay Description:Inhibition of ATM (unknown origin) using p53-Q10-K17 peptide substrate by alphascreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed
TargetPotassium voltage-gated channel subfamily H member 2(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50043386BDBM50043386(CHEMBL3355073)
Affinity DataIC50: 3.00E+4nMAssay Description:Inhibition of human ERG by automated whole cell electrophysiologyMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/19/2016
Entry Details Article
PubMed