BDBM50441574 CHEMBL2437163
SMILES Clc1ccc(OCC(=O)NNC(=S)NCCCCC2CCCCC2)cc1
InChI Key InChIKey=JRAYHZWPXHIVJI-UHFFFAOYSA-N
Data 5 IC50
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 5 hits for monomerid = 50441574
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Human)
University of Lille
Curated by ChEMBL
University of Lille
Curated by ChEMBL
Affinity DataIC50: 170nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Human)
University of Lille
Curated by ChEMBL
University of Lille
Curated by ChEMBL
Affinity DataIC50: 630nMAssay Description:Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst...More data for this Ligand-Target Pair
TargetDisintegrin and metalloproteinase domain-containing protein 17(Human)
University of Lille
Curated by ChEMBL
University of Lille
Curated by ChEMBL
Affinity DataIC50: 1.00E+4nMAssay Description:Inhibition of human TACE after 5 minsMore data for this Ligand-Target Pair
Affinity DataIC50: 1.00E+5nMAssay Description:Inhibition of human MMP-7 after 45 minsMore data for this Ligand-Target Pair
Affinity DataIC50: 1.00E+5nMAssay Description:Inhibition of human MMP-12 after 60 minsMore data for this Ligand-Target Pair
