BDBM50591583 CHEMBL5169760

SMILES CN1CCN(Cc2ccc(Nc3ncc(Cl)c(Nc4ccccc4-c4n[nH]c(C)n4)n3)cc2)CC1

InChI Key InChIKey=RJTVPQLMBWIFKC-UHFFFAOYSA-N

Data  5 IC50

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 5 hits for monomerid = 50591583   

TargetAurora kinase B(Human)
Hunan Normal University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50591583BDBM50591583(CHEMBL5169760)
Affinity DataIC50: 4nMAssay Description:Inhibition of human Aurora B using AKRRRLSSLRA as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/20/2023
Entry Details
PubMed
TargetTyrosine-protein kinase receptor UFO(Human)
Hunan Normal University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50591583BDBM50591583(CHEMBL5169760)
Affinity DataIC50: 11nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/20/2023
Entry Details
PubMed
TargetInsulin-like growth factor 1 receptor(Human)
Hunan Normal University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50591583BDBM50591583(CHEMBL5169760)
Affinity DataIC50: 103nMAssay Description:Inhibition of human IGF-1R using KKKSPGEYVNIEFG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysi...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/20/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK2(Human)
Hunan Normal University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50591583BDBM50591583(CHEMBL5169760)
Affinity DataIC50: 130nMAssay Description:Inhibition of human JAK2 using [protein fragment, 39 aa] as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintil...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/20/2023
Entry Details
PubMed
TargetALK tyrosine kinase receptor(Human)
Hunan Normal University

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50591583BDBM50591583(CHEMBL5169760)
Affinity DataIC50: 500nMAssay Description:Inhibition of human ALK using KKKSPGEYVNIEFG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/20/2023
Entry Details
PubMed