BDBM50602433 CHEMBL5199420::US11919896, Compound 1-8

SMILES O=C(CC#N)N1CC2(C1)CCC(CC2)c1cccc2nc(NC(=O)C3CC3)nn12

InChI Key InChIKey=ZFZCKEAERAZUAW-UHFFFAOYSA-N

Data  15 IC50

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 15 hits for monomerid = 50602433   

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602433(CHEMBL5199420 | US11919896, Compound 1-8)
Affinity DataIC50: 14nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602433(CHEMBL5199420 | US11919896, Compound 1-8)
Affinity DataIC50: 14nMAssay Description:JAK1:Dilution of JAK2, JAK3 and TYK2: 20 mM 3-(N-morpholine)propanesulfonic acid (MOPS), 1 mM EDTA, 0.01% Brij-35.5% glycerol, 0.1% β-mercaptoet...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2024
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602433(CHEMBL5199420 | US11919896, Compound 1-8)
Affinity DataIC50: 27nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602433(CHEMBL5199420 | US11919896, Compound 1-8)
Affinity DataIC50: 27nMAssay Description:TYK2:Dilution of JAK2, JAK3 and TYK2: 20 mM 3-(N-morpholine)propanesulfonic acid (MOPS), 1 mM EDTA, 0.01% Brij-35.5% glycerol, 0.1% β-mercaptoet...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2024
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602433(CHEMBL5199420 | US11919896, Compound 1-8)
Affinity DataIC50: 78nMAssay Description:Inhibition of recombinant human JAK2 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presence of Mg/ATP mixture b...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602433(CHEMBL5199420 | US11919896, Compound 1-8)
Affinity DataIC50: 78nMAssay Description:JAK2:Dilution of JAK2, JAK3 and TYK2: 20 mM 3-(N-morpholine)propanesulfonic acid (MOPS), 1 mM EDTA, 0.01% Brij-35.5% glycerol, 0.1% β-mercaptoet...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2024
Entry Details
US Patent

TargetTyrosine-protein kinase JAK3(Human)
Zhuhai United Laboratories Co.

US Patent
LigandPNGBDBM50602433(CHEMBL5199420 | US11919896, Compound 1-8)
Affinity DataIC50: 2.94E+3nMAssay Description:JAK3:Dilution of JAK2, JAK3 and TYK2: 20 mM 3-(N-morpholine)propanesulfonic acid (MOPS), 1 mM EDTA, 0.01% Brij-35.5% glycerol, 0.1% β-mercaptoet...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2024
Entry Details
US Patent

TargetTyrosine-protein kinase JAK3(Human)
Zhuhai United Laboratories Co.

US Patent
LigandPNGBDBM50602433(CHEMBL5199420 | US11919896, Compound 1-8)
Affinity DataIC50: 2.94E+3nMAssay Description:Inhibition of recombinant human JAK3 using GGEEEEYFELVKKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetCytochrome P450 2C8(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602433(CHEMBL5199420 | US11919896, Compound 1-8)
Affinity DataIC50: 1.00E+5nMAssay Description:Inhibition of CYP2C8 in human liver microsomes incubated in presence NADPH by LC-MS/MS analysisMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetCytochrome P450 1A2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602433(CHEMBL5199420 | US11919896, Compound 1-8)
Affinity DataIC50: 1.00E+5nMAssay Description:Inhibition of CYP1A2 in human liver microsomes incubated in presence NADPH by LC-MS/MS analysisMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetCytochrome P450 2D6(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602433(CHEMBL5199420 | US11919896, Compound 1-8)
Affinity DataIC50: 1.00E+5nMAssay Description:Inhibition of CYP2D6 in human liver microsomes incubated in presence NADPH by LC-MS/MS analysisMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetCytochrome P450 2C9(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602433(CHEMBL5199420 | US11919896, Compound 1-8)
Affinity DataIC50: 1.00E+5nMAssay Description:Inhibition of CYP2C9 in human liver microsomes incubated in presence NADPH by LC-MS/MS analysisMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetCytochrome P450 2B6(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602433(CHEMBL5199420 | US11919896, Compound 1-8)
Affinity DataIC50: 1.00E+5nMAssay Description:Inhibition of CYP2B6 in human liver microsomes incubated in presence NADPH by LC-MS/MS analysisMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetCytochrome P450 3A4(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602433(CHEMBL5199420 | US11919896, Compound 1-8)
Affinity DataIC50: 1.00E+5nMAssay Description:Inhibition of CYP3A4 in human liver microsomes incubated in presence NADPH by LC-MS/MS analysisMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetCytochrome P450 2C19(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602433(CHEMBL5199420 | US11919896, Compound 1-8)
Affinity DataIC50: 1.00E+5nMAssay Description:Inhibition of CYP2C19 in human liver microsomes incubated in presence NADPH by LC-MS/MS analysisMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed