BDBM148264 7-cyclopentyl-N,N-dimethyl-2-((5-(piperazin-1-yl)pyridin-2-yl)amino)-7H-pyrrolo[2,3-d]pyrimidine-6-carboxamide::Kisqali::LEE011::Ribociclib::US10570141, Comparative Example 1::US8962630, 74
SMILES CN(C)C(=O)c1cc2cnc(nc2n1C3CCCC3)Nc4ccc(cn4)N5CCNCC5
InChI Key InChIKey=RHXHGRAEPCAFML-UHFFFAOYSA-N
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 51 hits for monomerid = 148264
Affinity DataIC50: 2nMAssay Description:Inhibition of CDK4 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 2.14nMAssay Description:LANCE method of PerkinElmer Inc. was used in the assay, and recombinant CDK4/CyclinD3 (Item No.: 04-105) and CDK6/CyclinD3 (Item No.: 04-107) kinases...More data for this Ligand-Target Pair
Affinity DataIC50: 6nMAssay Description:Inhibition of CDK6 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 10nMAssay Description:Inhibition of human CDK4 incubated for 18 hrs by microscopic analysisMore data for this Ligand-Target Pair
Affinity DataIC50: 10nMpH: 7.5 T: 2°CAssay Description:A 384-well microtiter Lance TR-FRET (time-resolved-fluorescence energy transfer) endpoint assay was used for CDK4/cyclin D1 kinase activity measureme...More data for this Ligand-Target Pair
Affinity DataIC50: 10nMAssay Description:Inhibition of CDK4 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 10nMAssay Description:Inhibition of CDK4 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 10nMAssay Description:Inhibition of CDK4/CyclinD1 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 10nMAssay Description:Inhibition of CDK4 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 10nMAssay Description:Inhibition of CDK4 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 10nMAssay Description:Inhibition of CDK4/CyclinD1 (unknown origin) assessed as reduction in retinoblastoma phosphorylation at S473 residue by ELISAMore data for this Ligand-Target Pair
Affinity DataIC50: 13nMAssay Description:Inhibition of human CDK4/CyclinD3 by enzymatic radiometric assayMore data for this Ligand-Target Pair
Affinity DataIC50: 13nMAssay Description:Inhibition of recombinant human full length N-terminal GST-tagged CDK4/Cyclin-D3 co-expressed in baculovirus infected sf21 cells using Rb substrate i...More data for this Ligand-Target Pair
Affinity DataIC50: 13nMAssay Description:Inhibition of recombinant full-length human CDK4/cyclinD3 using Rb fragment as substrate measured after 40 mins in presence of [gamma33P]ATP by scint...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 6/G1/S-specific cyclin-D1(Human)
Peking Union Medical College
Curated by ChEMBL
Peking Union Medical College
Curated by ChEMBL
Affinity DataIC50: 20nMAssay Description:Inhibition of CDK6/cyclin D1 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 23nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 26.9nMAssay Description:LANCE method of PerkinElmer Inc. was used in the assay, and recombinant CDK4/CyclinD3 (Item No.: 04-105) and CDK6/CyclinD3 (Item No.: 04-107) kinases...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 6/G1/S-specific cyclin-D3(Human)
Beijing Normal University
Curated by ChEMBL
Beijing Normal University
Curated by ChEMBL
Affinity DataIC50: 28nMAssay Description:Inhibition of CDK6/Cyclin-D3 (unknown origin) using histoneH1 as substrate after 90 mins by ADP-Glo assayMore data for this Ligand-Target Pair
Affinity DataIC50: 29nMAssay Description:Inhibition of CDK4/cyclin D1 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 30nMAssay Description:Inhibition of GST-tagged CDK4/cyclin D1 (unknown origin) expressed in Baculovirus infected Sf9 cells using RPPTLSPIPHIPR peptide as substrate in pres...More data for this Ligand-Target Pair
Affinity DataIC50: 30nMAssay Description:Inhibition of human CDK4/cyclin D (unknown origin) using FAM-labeled peptide and ATP as substrate preincubated for 10 mins followed by substrate addi...More data for this Ligand-Target Pair
Affinity DataIC50: 39nMAssay Description:Inhibition of CDK6 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 39nMAssay Description:Inhibition of CDK6 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 39nMAssay Description:Inhibition of CDK6 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 39nMAssay Description:Inhibition of CDK6 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 39nMAssay Description:Inhibition of human CDK6 incubated for 18 hrs by microscopic analysisMore data for this Ligand-Target Pair
Affinity DataIC50: 39nMAssay Description:Inhibition of CDK6 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 51nMAssay Description:Inhibition of CDK4/Cyclin D1 in human MCF7 cellsMore data for this Ligand-Target Pair
Affinity DataIC50: 60nMAssay Description:Inhibition of CDK6/Cyclin D1 in human MCF7 cellsMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase 6/G1/S-specific cyclin-D3(Human)
Beijing Normal University
Curated by ChEMBL
Beijing Normal University
Curated by ChEMBL
Affinity DataIC50: 71nMAssay Description:Inhibition of recombinant full-length human CDK6/cyclinD3 using histone H1 as substrate measured after 40 mins in presence of [gamma33P]ATP by scinti...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 6/G1/S-specific cyclin-D3(Human)
Beijing Normal University
Curated by ChEMBL
Beijing Normal University
Curated by ChEMBL
Affinity DataIC50: 73nMAssay Description:Inhibition of CDK6/Cyclin D (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 197nMAssay Description:Inhibition of human CDK9/CyclinT1 by enzymatic radiometric assayMore data for this Ligand-Target Pair
Affinity DataIC50: 197nMAssay Description:Inhibition of recombinant full-length human CDK9/cyclinT1 using [protein fragment, 39 aa] peptide as substrate measured after 40 mins i...More data for this Ligand-Target Pair
Affinity DataIC50: 197nMAssay Description:Inhibition of recombinant human full length C-terminal 6His-tagged CDK9/Cyclin-T1 co-expressed in baculovirus infected sf21 cells using PDKtide subst...More data for this Ligand-Target Pair
Affinity DataIC50: 3.90E+3nMAssay Description:Inhibition of GST-tagged CDK9/CyclinT1 (unknown origin) expressed in Baculovirus infected Sf9 cells using YSPTSPS-2 KK peptide as substrate as substr...More data for this Ligand-Target Pair
Affinity DataIC50: 1.50E+4nMAssay Description:The assay was run under the conditions identical to that for CDK1/cyclin B except 0.25 nM CDK1/cyclin B was replaced with 0.3 nM CDK2/cyclin A. A 384...More data for this Ligand-Target Pair
Affinity DataIC50: 1.50E+4nMT: 2°CAssay Description:A 384-well microtiter IMAP-FPT (Molecular Devices Trade Mark Technology) endpoint assay was used for CDK1/cyclin B kinase activity measurements. The ...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Human)
Shanghaitech University
Curated by ChEMBL
Shanghaitech University
Curated by ChEMBL
Affinity DataIC50: 2.00E+4nMAssay Description:Inhibition of CDK1/cyclin B1 (unknown origin) using FAM-labeled peptide and ATP as substrate preincubated for 10 mins followed by substrate addition ...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 2/G1/S-specific cyclin-E1(Human)
Shanghaitech University
Curated by ChEMBL
Shanghaitech University
Curated by ChEMBL
Affinity DataIC50: 2.00E+4nMAssay Description:Inhibition of human CDK2/cyclin E (unknown origin) using FAM-labeled peptide and ATP as substrate preincubated for 10 mins followed by substrate addi...More data for this Ligand-Target Pair
TargetCDK-activating kinase assembly factor MAT1/Cyclin-H/Cyclin-dependent kinase 7(Human)
Palack£
Curated by ChEMBL
Palack£
Curated by ChEMBL
Affinity DataIC50: 2.00E+4nMAssay Description:Inhibition of GST-tagged CDK7/cyclinH/MAT1 (unknown origin) expressed in Baculovirus infected Sf9 cells using YSPTSPS-2 KK peptide as substrate as su...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Human)
Shanghaitech University
Curated by ChEMBL
Shanghaitech University
Curated by ChEMBL
Affinity DataIC50: 2.00E+4nMAssay Description:Inhibition of His-tagged CDK1/cyclin B1 (unknown origin) expressed in Baculovirus infected Sf9 cells using histone H1 as substrate in presence of [ga...More data for this Ligand-Target Pair
Affinity DataIC50: 2.00E+4nMAssay Description:Inhibition of GST-tagged CDK2/cyclin A2 (unknown origin) expressed in Escherichia coli using histone H1 as substrate in presence of [gamma-33P]-ATP b...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 2/G1/S-specific cyclin-E1(Human)
Shanghaitech University
Curated by ChEMBL
Shanghaitech University
Curated by ChEMBL
Affinity DataIC50: 2.00E+4nMAssay Description:Inhibition of CDK2/Cyclin E (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 2.00E+4nMAssay Description:Inhibition of GST-tagged CDK5/p25 (unknown origin) expressed in Baculovirus infected Sf9 cells using histone H1 as substrate as substrate in presence...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 2/G1/S-specific cyclin-E1(Human)
Shanghaitech University
Curated by ChEMBL
Shanghaitech University
Curated by ChEMBL
Affinity DataIC50: 2.00E+4nMAssay Description:Inhibition of His-tagged CDK2/cyclin E (unknown origin) expressed in Baculovirus infected Sf9 cells using histone H1 as substrate in presence of [gam...More data for this Ligand-Target Pair
Affinity DataIC50: 5.00E+4nMAssay Description:Inhibition of CDK1 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 5.00E+4nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 5.00E+4nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 7.60E+4nMAssay Description:Inhibition of CDK2/CyclinA (unknown origin) assessed as reduction in TAMRA tagged peptide substrate phosphorylation by fluorescence polarization assa...More data for this Ligand-Target Pair
Affinity DataIC50: 7.60E+4nMAssay Description:The assay was run under the conditions identical to that for CDK1/cyclin B except 0.25 nM CDK1/cyclin B was replaced with 0.3 nM CDK2/cyclin A. A 384...More data for this Ligand-Target Pair

3D Structure (crystal)