BDBM50139171 Dinaciclib::MK-7965::SCH-727965::US11643396, Example Dinaciclib::US20230416221, Compound Dinaciclib::US20250101023, Example Dinaciclib
SMILES CCc1cnn2c(NCc3ccc[n+]([O-])c3)cc(nc12)N1CCCC[C@H]1CCO
InChI Key InChIKey=PIMQWRZWLQKKBJ-UHFFFAOYSA-N
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 138 hits for monomerid = 50139171
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK5 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated Histone H1 as substrate after 1...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK2 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated Histone H1 as substrate after 1...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK5 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2 (unknown origin) expressed in baculovirus infected Sf9 insect cells using histone H1 as substrate after 1 hr by liquid scintillati...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
TargetPlatelet-derived growth factor receptor alpha/beta(Mouse)
University of South Australia
Curated by ChEMBL
University of South Australia
Curated by ChEMBL
Affinity DataKi: 1nMAssay Description:Inhibition of CDK2/cyclin E (unknown origin) assessed as inhibition constantMore data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK5 (unknown origin) expressed in baculovirus infected Sf9 cells using a histone H1-derived substrate incubated for 1 hr i...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK5 (unknown origin) expressed in baculovirus infected Sf9 insect cells using histone H1 as substrate after 1 hr by liquid scintillati...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of human CDK2More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK2 (unknown origin) expressed in baculovirus infected Sf9 cells using a histone H1-derived substrate incubated for 1 hr i...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 4(Human)
Csir-Indian Institute of Integrative Medicine
Curated by ChEMBL
Csir-Indian Institute of Integrative Medicine
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK4 (unknown origin)More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 5 activator 1(Human)
The People'S Hospital of Xinjiang Uyghur Autonomous Region
Curated by ChEMBL
The People'S Hospital of Xinjiang Uyghur Autonomous Region
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK5/p35 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK5 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK5 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK5 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 1(Human)
Csir-Indian Institute of Integrative Medicine
Curated by ChEMBL
Csir-Indian Institute of Integrative Medicine
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK1 (unknown origin)More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 5 activator 1(Human)
The People'S Hospital of Xinjiang Uyghur Autonomous Region
Curated by ChEMBL
The People'S Hospital of Xinjiang Uyghur Autonomous Region
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK5/p25 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated histone H1 as substrate aft...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK2 (unknown origin) expressed in baculovirus infected Sf9 cells using biotinylated Histone H1 peptide as substrate incuba...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK5 (unknown origin) expressed in baculovirus infected Sf9 cells using biotinylated Histone H1 peptide as substrate incuba...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK5 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK5 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated-histone H1 as substrate incubat...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of Cdk5 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK5 (unknown origin)More data for this Ligand-Target Pair
TargetCyclin-A2/Cyclin-dependent kinase 2(Human)
University of Nebraska Medical Center
Curated by ChEMBL
University of Nebraska Medical Center
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK2/cyclin A (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated histone H1 as substrat...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK5 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK2 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated-histone H1 as substrate incubat...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK5 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK2 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated peptide as substrate after 1 hr...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 1(Human)
Csir-Indian Institute of Integrative Medicine
Curated by ChEMBL
Csir-Indian Institute of Integrative Medicine
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK1 (unknown origin) expressed in Sf9 insect cells using biotinylated peptide derived Histone H1 as substrate incubated for 1 hr in pr...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK5 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated peptide as substrate after 1 hr...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2 (unknown origin) expressed in Sf9 insect cells using biotinylated peptide derived Histone H1 as substrate incubated for 1 hr in pr...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 4(Human)
Csir-Indian Institute of Integrative Medicine
Curated by ChEMBL
Csir-Indian Institute of Integrative Medicine
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK4 (unknown origin) expressed in Sf9 insect cells incubated for 1 hr in presence of [gamma33P]ATP by liquid scintillation counter met...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK5 (unknown origin) expressed in Sf9 insect cells using biotinylated peptide derived Histone H1 as substrate incubated for 1 hr in pr...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK9 (unknown origin) expressed in Sf9 insect cells using biotinylated peptide derived Histone H1 as substrate incubated for 1 hr in pr...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 5 activator 1(Human)
The People'S Hospital of Xinjiang Uyghur Autonomous Region
Curated by ChEMBL
The People'S Hospital of Xinjiang Uyghur Autonomous Region
Curated by ChEMBL
Affinity DataIC50: 1.60nMAssay Description:Inhibition of full length N-terminal GST fused human CDK5(1 to 292 residues)/ p25 (99 to 307 residues) expressed in baculovirus expression system usi...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:Inhibition of His-tagged CDK2/Cyclin-E1 (unknown origin) expressed in baculovirus infected Sf9 insect cells using histone H1 as substrate measured in...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:Inhibition of CDK2/Cyclin E (unknown origin) expressed in sf9 cells using histone H1 as substrate in presence of [gamma33P]-ATPMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase 1(Human)
Csir-Indian Institute of Integrative Medicine
Curated by ChEMBL
Csir-Indian Institute of Integrative Medicine
Curated by ChEMBL
Affinity DataIC50: 2nMAssay Description:Inhibition of recombinant CDK1 (unknown origin) expressed in baculovirus infected Sf9 cells using a histone H1-derived substrate incubated for 1 hr i...More data for this Ligand-Target Pair
Affinity DataIC50: 2.10nMAssay Description:Inhibition of CDK5 (unknown origin) by FRET assayMore data for this Ligand-Target Pair
Affinity DataIC50: 2.70nMAssay Description:Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Affinity DataIC50: 2.80nMAssay Description:Inhibition of CDK2 (unknown origin) using ULight 4EBP1 peptide as substrate incubated for 1 hr in presence of ATP by FRET assayMore data for this Ligand-Target Pair
