BDBM50602418 CHEMBL5193147::US11919896, Compound 6-7

SMILES FC1(F)C[C@H]1C(=O)N1CCC2(CC[C@@H](C2)c2cccc3nc(NC(=O)C4CC4)nn23)CC1

InChI Key InChIKey=QEDMOQUVDLNINX-HOTGVXAUSA-N

Data  8 IC50

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 8 hits for monomerid = 50602418   

TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602418(CHEMBL5193147 | US11919896, Compound 6-7)
Affinity DataIC50:  63nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602418(CHEMBL5193147 | US11919896, Compound 6-7)
Affinity DataIC50:  998nMAssay Description:Inhibition of recombinant human JAK2 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presence of Mg/ATP mixture b...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK3(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602418(CHEMBL5193147 | US11919896, Compound 6-7)
Affinity DataIC50:  9.39E+3nMAssay Description:Inhibition of recombinant human JAK3 using GGEEEEYFELVKKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK3(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602418(CHEMBL5193147 | US11919896, Compound 6-7)
Affinity DataIC50:  9.39E+3nMAssay Description:JAK3:Dilution of JAK2, JAK3 and TYK2: 20 mM 3-(N-morpholine)propanesulfonic acid (MOPS), 1 mM EDTA, 0.01% Brij-35.5% glycerol, 0.1% β-mercaptoet...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
ZHUHAI UNITED LABORATORIES CO., LTD.

US Patent
LigandPNGBDBM50602418(CHEMBL5193147 | US11919896, Compound 6-7)
Affinity DataIC50:  829nMAssay Description:TYK2:Dilution of JAK2, JAK3 and TYK2: 20 mM 3-(N-morpholine)propanesulfonic acid (MOPS), 1 mM EDTA, 0.01% Brij-35.5% glycerol, 0.1% β-mercaptoet...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602418(CHEMBL5193147 | US11919896, Compound 6-7)
Affinity DataIC50:  63nMAssay Description:JAK1:Dilution of JAK2, JAK3 and TYK2: 20 mM 3-(N-morpholine)propanesulfonic acid (MOPS), 1 mM EDTA, 0.01% Brij-35.5% glycerol, 0.1% β-mercaptoet...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602418(CHEMBL5193147 | US11919896, Compound 6-7)
Affinity DataIC50:  998nMAssay Description:JAK2:Dilution of JAK2, JAK3 and TYK2: 20 mM 3-(N-morpholine)propanesulfonic acid (MOPS), 1 mM EDTA, 0.01% Brij-35.5% glycerol, 0.1% β-mercaptoet...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
ZHUHAI UNITED LABORATORIES CO., LTD.

US Patent
LigandPNGBDBM50602418(CHEMBL5193147 | US11919896, Compound 6-7)
Affinity DataIC50:  829nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed