Compile Data Set for Download or QSAR
Report error Found 2469 Enz. Inhib. hit(s) with Target = '3-phosphoinositide-dependent protein kinase 1'
LigandChemical structure of BindingDB Monomer ID 50361649BDBM50361649(CHEMBL1938415)
Affinity DataKi:  0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In Depth
Date in BDB:
7/22/2012
Entry Details Article
PubMed
LigandChemical structure of BindingDB Monomer ID 50361648BDBM50361648(CHEMBL1940246)
Affinity DataKi:  0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In Depth
Date in BDB:
7/22/2012
Entry Details Article
PubMed
LigandChemical structure of BindingDB Monomer ID 50341250BDBM50341250(N-{(3R,5R)-1-[2-Amino-6-(3-amino-1H-indazol-6-yl)-...)
Affinity DataIC50: 0.631nMAssay Description:Inhibition of PDK1More data for this Ligand-Target Pair
In Depth
Date in BDB:
12/3/2011
Entry Details Article
PubMed
LigandChemical structure of BindingDB Monomer ID 50361642BDBM50361642(CHEMBL1940251)
Affinity DataKi:  0.700nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/22/2012
Entry Details Article
PubMed
LigandChemical structure of BindingDB Monomer ID 50341249BDBM50341249(1,1-Dimethylethyl{(3R,5R)-1-[2-Amino-6-(3-amino-1H...)
Affinity DataIC50: 0.794nMAssay Description:Inhibition of PDK1More data for this Ligand-Target Pair
In Depth
Date in BDB:
12/3/2011
Entry Details Article
PubMed
LigandChemical structure of BindingDB Monomer ID 50361641BDBM50361641(CHEMBL1940247)
Affinity DataKi:  0.900nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In Depth
Date in BDB:
7/22/2012
Entry Details Article
PubMed
LigandChemical structure of BindingDB Monomer ID 139837BDBM139837(US8895581, III-23)
Affinity DataIC50: 1nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/4/2015
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 139798BDBM139798(US8895581, II-19)
Affinity DataIC50: 1nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/4/2015
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 50361645BDBM50361645(CHEMBL1234429 | US9873693, Compound 144)
Affinity DataEC50:  1nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In Depth
Date in BDB:
7/22/2012
Entry Details Article
PubMed
LigandChemical structure of BindingDB Monomer ID 139845BDBM139845(US8895581, III-31)
Affinity DataIC50: 1nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/4/2015
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 50361652BDBM50361652(CHEMBL1940250)
Affinity DataKi:  1nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In Depth
Date in BDB:
7/22/2012
Entry Details Article
PubMed
LigandChemical structure of BindingDB Monomer ID 139840BDBM139840(US8895581, III-26)
Affinity DataIC50: 1nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/4/2015
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 26198BDBM26198(Jak Inhibitor 1 | CHEMBL21156 | Compound # 2 | 4-t...)
Affinity DataEC50:  1nMAssay Description:Enzyme potency (PDK1 EC50)was determined using recombinant, purified full-length human PDK1 enzyme and AKT-Thr-308-tide as substrate.More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/27/2012
Entry Details Article
PubMed
LigandChemical structure of BindingDB Monomer ID 139819BDBM139819(US8895581, III-5)
Affinity DataIC50: 1nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/4/2015
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 105303BDBM105303(US8575203, I-70)
Affinity DataIC50: 1nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/6/2014
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 105308BDBM105308(US8575203, I-75)
Affinity DataIC50: 1nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/6/2014
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 139785BDBM139785(US8895581, II-6)
Affinity DataIC50: 1nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/4/2015
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 139796BDBM139796(US8895581, II-17)
Affinity DataIC50: 1nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/4/2015
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 139828BDBM139828(US8895581, III-14)
Affinity DataIC50: 1nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/4/2015
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 92406BDBM92406(PDK1 inhibitor, 7)
Affinity DataEC50:  1nMAssay Description:Enzyme potency (PDK1 EC50)was determined using recombinant, purified full-length human PDK1 enzyme and AKT-Thr-308-tide as substrate.More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/27/2012
Entry Details Article
PubMedPDB3D3D Structure (crystal)
LigandChemical structure of BindingDB Monomer ID 139765BDBM139765(US8895581, I-1)
Affinity DataIC50: 1nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/4/2015
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 105283BDBM105283(US8575203, I-50)
Affinity DataIC50: 1nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/6/2014
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 50361650BDBM50361650(CHEMBL1940248)
Affinity DataKi:  1.30nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In Depth
Date in BDB:
7/22/2012
Entry Details Article
PubMed
LigandChemical structure of BindingDB Monomer ID 50361644BDBM50361644(CHEMBL1940253)
Affinity DataKi:  1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/22/2012
Entry Details Article
PubMed
LigandChemical structure of BindingDB Monomer ID 50361643BDBM50361643(CHEMBL1940252)
Affinity DataKi:  1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/22/2012
Entry Details Article
PubMed
LigandChemical structure of BindingDB Monomer ID 50341241BDBM50341241((3S,6R)-1-[6-(3-Amino-1H-indazol-6-yl)-2-(methylam...)
Affinity DataIC50: 1.60nMAssay Description:Inhibition of PDK1More data for this Ligand-Target Pair
In Depth
Date in BDB:
12/3/2011
Entry Details Article
PubMed
LigandChemical structure of BindingDB Monomer ID 2579BDBM2579(CHEMBL388978 | Staurosporine, 8 | Staurosporin, 4 ...)
Affinity DataKd:  1.70nMAssay Description:Binding constant for full-length PDPK1More data for this Ligand-Target Pair
In Depth
Date in BDB:
12/25/2012
Entry Details Article
PubMed
LigandChemical structure of BindingDB Monomer ID 2579BDBM2579(CHEMBL388978 | Staurosporine, 8 | Staurosporin, 4 ...)
Affinity DataKd:  1.70nMAssay Description:Binding constant for PDPK1 kinase domainMore data for this Ligand-Target Pair
In Depth
Date in BDB:
7/19/2012
Entry Details Article
PubMed
LigandChemical structure of BindingDB Monomer ID 31096BDBM31096(CHEMBL290084 | Staurosporine | cid_451705 | US2024...)
Affinity DataKd:  1.70nMAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In Depth
Date in BDB:
4/23/2011
Entry Details
PCBioAssay
LigandChemical structure of BindingDB Monomer ID 50361653BDBM50361653(CHEMBL1940245)
Affinity DataKi:  2nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In Depth
Date in BDB:
7/22/2012
Entry Details Article
PubMed
LigandChemical structure of BindingDB Monomer ID 105294BDBM105294(US8575203, I-61)
Affinity DataIC50: 2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/6/2014
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 105358BDBM105358(US8575203, I-125)
Affinity DataIC50: 2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/6/2014
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 139789BDBM139789(US8895581, II-20 | US8895581, II-13 | US8895581, I...)
Affinity DataIC50: 2nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/4/2015
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 105357BDBM105357(US8575203, I-124)
Affinity DataIC50: 2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/6/2014
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 139800BDBM139800(US8895581, II-21)
Affinity DataIC50: 2nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/4/2015
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 105356BDBM105356(US8575203, I-123)
Affinity DataIC50: 2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/6/2014
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 105295BDBM105295(US8575203, I-62)
Affinity DataIC50: 2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/6/2014
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 139809BDBM139809(US8895581, II-30)
Affinity DataIC50: 2nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/4/2015
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 105305BDBM105305(US8575203, I-72)
Affinity DataIC50: 2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/6/2014
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 139820BDBM139820(US8895581, III-6)
Affinity DataIC50: 2nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/4/2015
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 105367BDBM105367(US8575203, I-125.9)
Affinity DataIC50: 2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/6/2014
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 105309BDBM105309(US8575203, I-76)
Affinity DataIC50: 2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/6/2014
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 139816BDBM139816(US8895581, III-2)
Affinity DataIC50: 2nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/4/2015
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 105376BDBM105376(US8575203, I-125.18)
Affinity DataIC50: 2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/6/2014
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 105375BDBM105375(US8575203, I-125.17)
Affinity DataIC50: 2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/6/2014
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 105379BDBM105379(US8575203, I-125.21)
Affinity DataIC50: 2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/6/2014
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 139768BDBM139768(US8895581, I-4)
Affinity DataIC50: 2nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/4/2015
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 139842BDBM139842(US8895581, III-28)
Affinity DataIC50: 2nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/4/2015
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 139780BDBM139780(US8895581, II-1)
Affinity DataIC50: 2nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/4/2015
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 105263BDBM105263(US8575203, I-30)
Affinity DataIC50: 2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/6/2014
Entry Details
US Patent

Displayed 1 to 50 (of 2469 total ) | Next | Last >>
Jump to: