Report error Found 107 with Last Name = 'rudewicz' and Initial = 'p'
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 0.100nMAssay Description:Inhibition of human ATR using ATP substrate measured after 3 hrsMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 0.200nMAssay Description:Inhibition of human ATR using ATP substrate measured after 3 hrsMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 0.300nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 0.400nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 0.400nMAssay Description:Inhibition of human ATR using ATP substrate measured after 3 hrsMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 0.5nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 0.5nMAssay Description:Inhibition of human ATR using ATP substrate measured after 3 hrsMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 0.5nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of human ATR using ATP substrate measured after 3 hrsMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 2nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 5nMAssay Description:Inhibition of human ATR using ATP substrate measured after 3 hrsMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 6nMAssay Description:Inhibition of human ATR using ATP substrate measured after 3 hrsMore data for this Ligand-Target Pair
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 9nMAssay Description:Inhibition of PI3Kalpha (unknown origin)More data for this Ligand-Target Pair
TargetDual specificity mitogen-activated protein kinase kinase 1(Human)
Argenta Discovery
Curated by ChEMBL
Argenta Discovery
Curated by ChEMBL
Affinity DataIC50: 13nMAssay Description:Inhibition of MEK1-mediated ERK1 phosphorylation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
TargetDual specificity mitogen-activated protein kinase kinase 1(Human)
Argenta Discovery
Curated by ChEMBL
Argenta Discovery
Curated by ChEMBL
Affinity DataIC50: 15nMAssay Description:Inhibition of MEK1-mediated ERK1 phosphorylation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
TargetDual specificity mitogen-activated protein kinase kinase 1(Human)
Argenta Discovery
Curated by ChEMBL
Argenta Discovery
Curated by ChEMBL
Affinity DataIC50: 15nMAssay Description:Inhibition of MEK1-mediated ERK1 phosphorylation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
TargetDual specificity mitogen-activated protein kinase kinase 1(Human)
Argenta Discovery
Curated by ChEMBL
Argenta Discovery
Curated by ChEMBL
Affinity DataIC50: 20nMAssay Description:Inhibition of MEK1-mediated ERK1 phosphorylation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
TargetDual specificity mitogen-activated protein kinase kinase 1(Human)
Argenta Discovery
Curated by ChEMBL
Argenta Discovery
Curated by ChEMBL
Affinity DataIC50: 25nMAssay Description:Inhibition of MEK1-mediated ERK1 phosphorylation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 26nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 26nMAssay Description:Inhibition of human ATR using ATP substrate measured after 3 hrsMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 29nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 34nMAssay Description:Inhibition of human ATR using ATP substrate measured after 3 hrsMore data for this Ligand-Target Pair
TargetDual specificity mitogen-activated protein kinase kinase 1(Human)
Argenta Discovery
Curated by ChEMBL
Argenta Discovery
Curated by ChEMBL
Affinity DataIC50: 35nMAssay Description:Inhibition of MEK1-mediated ERK1 phosphorylation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 37nMAssay Description:Inhibition of CHK1 in HeLa S3 cells assessed as inhibition of phosphorylation at ser345 by AlphaScreen SureFire CHK1 (p-Ser345) assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 39nMAssay Description:Inhibition of human ATR using ATP substrate measured after 3 hrsMore data for this Ligand-Target Pair
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 40nMAssay Description:Inhibition of PI3Kalpha (unknown origin)More data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 41nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 44nMAssay Description:Inhibition of CHK1 in HeLa S3 cells assessed as inhibition of phosphorylation at ser345 by AlphaScreen SureFire CHK1 (p-Ser345) assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 64nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
TargetDual specificity mitogen-activated protein kinase kinase 1(Human)
Argenta Discovery
Curated by ChEMBL
Argenta Discovery
Curated by ChEMBL
Affinity DataIC50: 79nMAssay Description:Inhibition of MEK1-mediated ERK1 phosphorylation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 80nMAssay Description:Inhibition of full-length Chk1 in HeLa S3 cells assessed as phosphorylation at Ser345 after 4 hrsMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 80nMAssay Description:Inhibition of CHK1 in HeLa S3 cells assessed as inhibition of phosphorylation at ser345 by AlphaScreen SureFire CHK1 (p-Ser345) assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 84nMAssay Description:Inhibition of full-length Chk1 in HeLa S3 cells assessed as phosphorylation at Ser345 after 4 hrsMore data for this Ligand-Target Pair
TargetDual specificity mitogen-activated protein kinase kinase 1(Human)
Argenta Discovery
Curated by ChEMBL
Argenta Discovery
Curated by ChEMBL
Affinity DataIC50: 93nMAssay Description:Inhibition of MEK1-mediated ERK1 phosphorylation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 95nMAssay Description:Inhibition of human ATR using ATP substrate measured after 3 hrsMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 96nMAssay Description:Inhibition of human ATR using ATP substrate measured after 3 hrsMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 96nMAssay Description:Inhibition of full-length Chk1 in HeLa S3 cells assessed as phosphorylation at Ser345 after 4 hrsMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 123nMAssay Description:Inhibition of CHK1 in HeLa S3 cells assessed as inhibition of phosphorylation at ser345 by AlphaScreen SureFire CHK1 (p-Ser345) assayMore data for this Ligand-Target Pair
TargetDual specificity mitogen-activated protein kinase kinase 1(Human)
Argenta Discovery
Curated by ChEMBL
Argenta Discovery
Curated by ChEMBL
Affinity DataIC50: 125nMAssay Description:Inhibition of MEK1-mediated ERK1 phosphorylation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
Affinity DataIC50: 130nMAssay Description:Inhibition of ATM (unknown origin) using p53-Q10-K17 peptide substrate by alphascreen assayMore data for this Ligand-Target Pair
TargetDNA-dependent protein kinase catalytic subunit(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 140nMAssay Description:Inhibition of DNA-PK (unknown origin) using GGGGMEEPQSDPSVEPPLSQETFSDLWKLLPE peptide substrate by alphascreen assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 160nMAssay Description:Inhibition of CHK1 in HeLa S3 cells assessed as inhibition of phosphorylation at ser345 by AlphaScreen SureFire CHK1 (p-Ser345) assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 190nMAssay Description:Inhibition of human ATR using ATP substrate measured after 3 hrsMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 327nMAssay Description:Inhibition of CHK1 in HeLa S3 cells assessed as inhibition of phosphorylation at ser345 by AlphaScreen SureFire CHK1 (p-Ser345) assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 440nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 1.10E+3nMAssay Description:Inhibition of PI3Kalpha (unknown origin)More data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase mTOR(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 1.10E+3nMAssay Description:Inhibition of mTOR (unknown origin) by alphascreen SureFire p70 S6K (p-Thr389) assayMore data for this Ligand-Target Pair
TargetPotassium voltage-gated channel subfamily H member 2(Human)
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Novartis Institutes For Biomedical Research
Curated by ChEMBL
Affinity DataIC50: 1.50E+3nMAssay Description:Inhibition of human ERG by automated whole cell electrophysiologyMore data for this Ligand-Target Pair