Compile Data Set for Download or QSAR
maximum 50k data
Report error Found 107 with Last Name = 'rudewicz' and Initial = 'p'
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043407(CHEMBL3355476)
Affinity DataIC50:  0.100nMAssay Description:Inhibition of human ATR using ATP substrate measured after 3 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043409(CHEMBL3355474)
Affinity DataIC50:  0.200nMAssay Description:Inhibition of human ATR using ATP substrate measured after 3 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043385(CHEMBL3355072)
Affinity DataIC50:  0.300nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043387(CHEMBL3355074)
Affinity DataIC50:  0.400nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043408(CHEMBL3355475)
Affinity DataIC50:  0.400nMAssay Description:Inhibition of human ATR using ATP substrate measured after 3 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043382(CHEMBL3355069)
Affinity DataIC50:  0.5nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043411(CHEMBL3355480)
Affinity DataIC50:  0.5nMAssay Description:Inhibition of human ATR using ATP substrate measured after 3 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043384(CHEMBL3355071)
Affinity DataIC50:  0.5nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043383(CHEMBL3355070)
Affinity DataIC50:  1nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043410(CHEMBL3355473)
Affinity DataIC50:  1nMAssay Description:Inhibition of human ATR using ATP substrate measured after 3 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043386(CHEMBL3355073)
Affinity DataIC50:  1nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043389(CHEMBL3352844)
Affinity DataIC50:  2nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043403(CHEMBL3355472)
Affinity DataIC50:  5nMAssay Description:Inhibition of human ATR using ATP substrate measured after 3 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043413(CHEMBL3355478)
Affinity DataIC50:  6nMAssay Description:Inhibition of human ATR using ATP substrate measured after 3 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043381(CHEMBL3355068)
Affinity DataIC50:  9nMAssay Description:Inhibition of PI3Kalpha (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM50420692(CHEMBL2087076)
Affinity DataIC50:  13nMAssay Description:Inhibition of MEK1-mediated ERK1 phosphorylation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
LigandPNGBDBM50420696(CHEMBL2087080)
Affinity DataIC50:  15nMAssay Description:Inhibition of MEK1-mediated ERK1 phosphorylation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM50420701(CHEMBL2087461)
Affinity DataIC50:  15nMAssay Description:Inhibition of MEK1-mediated ERK1 phosphorylation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM50420702(CHEMBL2087462)
Affinity DataIC50:  20nMAssay Description:Inhibition of MEK1-mediated ERK1 phosphorylation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM50420693(CHEMBL2087077)
Affinity DataIC50:  25nMAssay Description:Inhibition of MEK1-mediated ERK1 phosphorylation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043381(CHEMBL3355068)
Affinity DataIC50:  26nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043404(CHEMBL3352848)
Affinity DataIC50:  26nMAssay Description:Inhibition of human ATR using ATP substrate measured after 3 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043388(CHEMBL3355075)
Affinity DataIC50:  29nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043414(CHEMBL3355477)
Affinity DataIC50:  34nMAssay Description:Inhibition of human ATR using ATP substrate measured after 3 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM50420694(CHEMBL2087078)
Affinity DataIC50:  35nMAssay Description:Inhibition of MEK1-mediated ERK1 phosphorylation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043387(CHEMBL3355074)
Affinity DataIC50:  37nMAssay Description:Inhibition of CHK1 in HeLa S3 cells assessed as inhibition of phosphorylation at ser345 by AlphaScreen SureFire CHK1 (p-Ser345) assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043415(CHEMBL3355471)
Affinity DataIC50:  39nMAssay Description:Inhibition of human ATR using ATP substrate measured after 3 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043382(CHEMBL3355069)
Affinity DataIC50:  40nMAssay Description:Inhibition of PI3Kalpha (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043401(CHEMBL3355079)
Affinity DataIC50:  41nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043382(CHEMBL3355069)
Affinity DataIC50:  44nMAssay Description:Inhibition of CHK1 in HeLa S3 cells assessed as inhibition of phosphorylation at ser345 by AlphaScreen SureFire CHK1 (p-Ser345) assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043402(CHEMBL3355080)
Affinity DataIC50:  64nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM50420697(CHEMBL2087081)
Affinity DataIC50:  79nMAssay Description:Inhibition of MEK1-mediated ERK1 phosphorylation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043409(CHEMBL3355474)
Affinity DataIC50:  80nMAssay Description:Inhibition of full-length Chk1 in HeLa S3 cells assessed as phosphorylation at Ser345 after 4 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043385(CHEMBL3355072)
Affinity DataIC50:  80nMAssay Description:Inhibition of CHK1 in HeLa S3 cells assessed as inhibition of phosphorylation at ser345 by AlphaScreen SureFire CHK1 (p-Ser345) assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043408(CHEMBL3355475)
Affinity DataIC50:  84nMAssay Description:Inhibition of full-length Chk1 in HeLa S3 cells assessed as phosphorylation at Ser345 after 4 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM50420698(CHEMBL2087082)
Affinity DataIC50:  93nMAssay Description:Inhibition of MEK1-mediated ERK1 phosphorylation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043405(CHEMBL3355470)
Affinity DataIC50:  95nMAssay Description:Inhibition of human ATR using ATP substrate measured after 3 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043406(CHEMBL3355469)
Affinity DataIC50:  96nMAssay Description:Inhibition of human ATR using ATP substrate measured after 3 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043407(CHEMBL3355476)
Affinity DataIC50:  96nMAssay Description:Inhibition of full-length Chk1 in HeLa S3 cells assessed as phosphorylation at Ser345 after 4 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043384(CHEMBL3355071)
Affinity DataIC50:  123nMAssay Description:Inhibition of CHK1 in HeLa S3 cells assessed as inhibition of phosphorylation at ser345 by AlphaScreen SureFire CHK1 (p-Ser345) assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM50420695(CHEMBL2087079)
Affinity DataIC50:  125nMAssay Description:Inhibition of MEK1-mediated ERK1 phosphorylation after 30 mins by HTRF assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine-protein kinase ATM(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043385(CHEMBL3355072)
Affinity DataIC50:  130nMAssay Description:Inhibition of ATM (unknown origin) using p53-Q10-K17 peptide substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDNA-dependent protein kinase catalytic subunit(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043385(CHEMBL3355072)
Affinity DataIC50:  140nMAssay Description:Inhibition of DNA-PK (unknown origin) using GGGGMEEPQSDPSVEPPLSQETFSDLWKLLPE peptide substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043386(CHEMBL3355073)
Affinity DataIC50:  160nMAssay Description:Inhibition of CHK1 in HeLa S3 cells assessed as inhibition of phosphorylation at ser345 by AlphaScreen SureFire CHK1 (p-Ser345) assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043412(CHEMBL3355479)
Affinity DataIC50:  190nMAssay Description:Inhibition of human ATR using ATP substrate measured after 3 hrsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043383(CHEMBL3355070)
Affinity DataIC50:  327nMAssay Description:Inhibition of CHK1 in HeLa S3 cells assessed as inhibition of phosphorylation at ser345 by AlphaScreen SureFire CHK1 (p-Ser345) assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043390(CHEMBL3355076)
Affinity DataIC50:  440nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043383(CHEMBL3355070)
Affinity DataIC50:  1.10E+3nMAssay Description:Inhibition of PI3Kalpha (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase mTOR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043385(CHEMBL3355072)
Affinity DataIC50:  1.10E+3nMAssay Description:Inhibition of mTOR (unknown origin) by alphascreen SureFire p70 S6K (p-Thr389) assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPotassium voltage-gated channel subfamily H member 2(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043385(CHEMBL3355072)
Affinity DataIC50:  1.50E+3nMAssay Description:Inhibition of human ERG by automated whole cell electrophysiologyMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Displayed 1 to 50 (of 107 total ) | Next | Last >>
Jump to: