TargetcAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A(Homo sapiens (Human))
Pfizer
Curated by ChEMBL
Pfizer
Curated by ChEMBL
Affinity DataKi: 0.100nMAssay Description:Inhibition of PDE10A by fluorescence polarization assayMore data for this Ligand-Target Pair
TargetcAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A(Homo sapiens (Human))
Pfizer
Curated by ChEMBL
Pfizer
Curated by ChEMBL
Affinity DataKi: 0.100nMAssay Description:Inhibition of PDE10A by fluorescence polarization assayMore data for this Ligand-Target Pair
Affinity DataKi: 0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
TargetcAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A(Homo sapiens (Human))
Pfizer
Curated by ChEMBL
Pfizer
Curated by ChEMBL
Affinity DataKi: 0.630nMAssay Description:Inhibition of PDE10A by fluorescence polarization assayMore data for this Ligand-Target Pair
Affinity DataKi: 0.700nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKi: 0.840nMAssay Description:In vitro binding affinity against human D2 dopamine receptor in CHO cells by [3H]-spiperone displacement.More data for this Ligand-Target Pair
TargetcAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A(Homo sapiens (Human))
Pfizer
Curated by ChEMBL
Pfizer
Curated by ChEMBL
Affinity DataKi: 0.900nMAssay Description:Inhibition of PDE10A by fluorescence polarization assayMore data for this Ligand-Target Pair
Affinity DataKi: 0.900nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
TargetcAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A(Homo sapiens (Human))
Pfizer
Curated by ChEMBL
Pfizer
Curated by ChEMBL
Affinity DataKi: 0.920nMAssay Description:Inhibition of PDE10A by fluorescence polarization assayMore data for this Ligand-Target Pair
TargetcAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A(Homo sapiens (Human))
Pfizer
Curated by ChEMBL
Pfizer
Curated by ChEMBL
Affinity DataKi: 0.950nMAssay Description:Inhibition of PDE10A by fluorescence polarization assayMore data for this Ligand-Target Pair
Affinity DataKi: 1nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 1.30nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKi: 1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKi: 1.60nMAssay Description:In vitro binding affinity at human D4 dopamine receptor in CHO cells by [3H]-spiperone displacment.More data for this Ligand-Target Pair
Affinity DataKi: 1.70nMAssay Description:In vitro binding affinity at human D4 dopamine receptor in CHO cells by [3H]-spiperone displacment.More data for this Ligand-Target Pair
Affinity DataKi: 1.70nMAssay Description:In vitro binding affinity at human D4 dopamine receptor in CHO cells by [3H]-spiperone displacment.More data for this Ligand-Target Pair
Affinity DataKi: 1.70nMAssay Description:In vitro binding affinity at human D4 dopamine receptor in CHO cells by [3H]-spiperone displacment.More data for this Ligand-Target Pair
Affinity DataKi: 2nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
TargetcAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A(Homo sapiens (Human))
Pfizer
Curated by ChEMBL
Pfizer
Curated by ChEMBL
Affinity DataKi: 2nMAssay Description:Inhibition of PDE10A by fluorescence polarization assayMore data for this Ligand-Target Pair
Affinity DataKi: 2nMAssay Description:In vitro binding affinity at human D4 dopamine receptor in CHO cells by [3H]-spiperone displacment.More data for this Ligand-Target Pair
TargetcAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A(Homo sapiens (Human))
Pfizer
Curated by ChEMBL
Pfizer
Curated by ChEMBL
Affinity DataKi: 2.20nMAssay Description:Inhibition of PDE10A by fluorescence polarization assayMore data for this Ligand-Target Pair
Affinity DataKi: 2.5nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 2.80nMAssay Description:In vitro binding affinity at human D4 dopamine receptor in CHO cells by [3H]-spiperone displacment.More data for this Ligand-Target Pair
Affinity DataKi: 3.20nMAssay Description:In vitro binding affinity at human D4 dopamine receptor in CHO cells by [3H]-spiperone displacment.More data for this Ligand-Target Pair
Affinity DataKi: 3.30nMAssay Description:In vitro binding affinity at human D4 dopamine receptor in CHO cells by [3H]-spiperone displacment.More data for this Ligand-Target Pair
Affinity DataKi: 3.40nMAssay Description:In vitro binding affinity at human D4 dopamine receptor in CHO cells by [3H]-spiperone displacment.More data for this Ligand-Target Pair
Affinity DataKi: 3.5nMAssay Description:In vitro binding affinity at human D4 dopamine receptor in CHO cells by [3H]-spiperone displacment.More data for this Ligand-Target Pair
Affinity DataKi: 3.80nMAssay Description:In vitro binding affinity at human D4 dopamine receptor in CHO cells by [3H]-spiperone displacment.More data for this Ligand-Target Pair
TargetcAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A(Rattus norvegicus (rat))
Pfizer
Pfizer
Affinity DataKi: 4nMAssay Description:PDE activity was monitored by measuring the hydrolysis of [3H]-cAMP to [3H]-AMP using a scintillation proximity assay (SPA). [3H]-AMP was captured by...More data for this Ligand-Target Pair
Affinity DataKi: 4.20nMAssay Description:Displacement of radiolabeled 4-(azetidin-1-yl)-3-[5-[4-(trifluoromethyl)phenyl]-1H-pyrazol-4-yl]-1-(tritritiomethyl)pyrazolo[3,4-d]pyrimidine from PD...More data for this Ligand-Target Pair
Affinity DataKi: 5.30nMAssay Description:In vitro binding affinity at human D4 dopamine receptor in CHO cells by [3H]-spiperone displacment.More data for this Ligand-Target Pair
Affinity DataKi: 10nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
TargetcAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A(Rattus norvegicus (rat))
Pfizer
Pfizer
Affinity DataKi: 12nMAssay Description:PDE activity was monitored by measuring the hydrolysis of [3H]-cAMP to [3H]-AMP using a scintillation proximity assay (SPA). [3H]-AMP was captured by...More data for this Ligand-Target Pair
TargetcAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A(Rattus norvegicus (rat))
Pfizer
Pfizer
Affinity DataKi: 12nMAssay Description:PDE activity was monitored by measuring the hydrolysis of [3H]-cAMP to [3H]-AMP using a scintillation proximity assay (SPA). [3H]-AMP was captured by...More data for this Ligand-Target Pair
TargetcAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A(Rattus norvegicus (rat))
Pfizer
Pfizer
Affinity DataKi: 12nMAssay Description:PDE activity was monitored by measuring the hydrolysis of [3H]-cAMP to [3H]-AMP using a scintillation proximity assay (SPA). [3H]-AMP was captured by...More data for this Ligand-Target Pair
TargetcAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A(Homo sapiens (Human))
Pfizer
Curated by ChEMBL
Pfizer
Curated by ChEMBL
Affinity DataKi: 15nMAssay Description:Inhibition of PDE10A by fluorescence polarization assayMore data for this Ligand-Target Pair
TargetcAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A(Rattus norvegicus (rat))
Pfizer
Pfizer
Affinity DataKi: 17nMAssay Description:PDE activity was monitored by measuring the hydrolysis of [3H]-cAMP to [3H]-AMP using a scintillation proximity assay (SPA). [3H]-AMP was captured by...More data for this Ligand-Target Pair
TargetcAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A(Rattus norvegicus (rat))
Pfizer
Pfizer
Affinity DataKi: 17nM ΔG°: -43.9kJ/molepH: 7.5 T: 2°CAssay Description:PDE activity was monitored by measuring the hydrolysis of [3H]-cAMP to [3H]-AMP using a scintillation proximity assay (SPA). [3H]-AMP was captured by...More data for this Ligand-Target Pair
Affinity DataKi: 18nMAssay Description:In vitro binding affinity at human D4 dopamine receptor in CHO cells by [3H]-spiperone displacment.More data for this Ligand-Target Pair
TargetcAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A(Rattus norvegicus (rat))
Pfizer
Pfizer
Affinity DataKi: 18nMAssay Description:PDE activity was monitored by measuring the hydrolysis of [3H]-cAMP to [3H]-AMP using a scintillation proximity assay (SPA). [3H]-AMP was captured by...More data for this Ligand-Target Pair
TargetcAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A(Rattus norvegicus (rat))
Pfizer
Pfizer
Affinity DataKi: 18nMAssay Description:PDE activity was monitored by measuring the hydrolysis of [3H]-cAMP to [3H]-AMP using a scintillation proximity assay (SPA). [3H]-AMP was captured by...More data for this Ligand-Target Pair
TargetcAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A(Rattus norvegicus (rat))
Pfizer
Pfizer
Affinity DataKi: 19nMAssay Description:PDE activity was monitored by measuring the hydrolysis of [3H]-cAMP to [3H]-AMP using a scintillation proximity assay (SPA). [3H]-AMP was captured by...More data for this Ligand-Target Pair
Affinity DataKi: 20nMAssay Description:In vitro binding affinity at human D4 dopamine receptor in CHO cells by [3H]-spiperone displacment.More data for this Ligand-Target Pair
TargetcAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A(Rattus norvegicus (rat))
Pfizer
Pfizer
Affinity DataKi: 25nM ΔG°: -43.0kJ/molepH: 7.5 T: 2°CAssay Description:PDE activity was monitored by measuring the hydrolysis of [3H]-cAMP to [3H]-AMP using a scintillation proximity assay (SPA). [3H]-AMP was captured by...More data for this Ligand-Target Pair
Affinity DataKi: 35nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 38nMAssay Description:In vitro binding affinity against human D2 dopamine receptor in CHO cells by [3H]-spiperone displacement.More data for this Ligand-Target Pair
Affinity DataKi: 38nMAssay Description:In vitro binding affinity against human D2 dopamine receptor in CHO cells by [3H]-spiperone displacement.More data for this Ligand-Target Pair
Affinity DataKi: 39nMAssay Description:In vitro binding affinity at human D4 dopamine receptor in CHO cells by [3H]-spiperone displacment.More data for this Ligand-Target Pair