Compile Data Set for Download or QSAR
maximum 50k data
Found 148 with Last Name = 'cotterell' and Initial = 'a'
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231952(CHEMBL4081554)
Affinity DataKi:  0.110nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231900(CHEMBL4060480)
Affinity DataKi:  0.230nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50261506(CHEMBL499930 | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-NH2)
Affinity DataKi:  0.320nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231888(CHEMBL4081357)
Affinity DataKi:  0.350nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231942(CHEMBL4065403)
Affinity DataKi:  0.470nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231949(CHEMBL4069162)
Affinity DataKi:  0.490nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231943(CHEMBL4093072)
Affinity DataKi:  0.490nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231887(CHEMBL4091638)
Affinity DataKi:  0.520nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231894(CHEMBL4100325)
Affinity DataKi:  0.800nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231902(CHEMBL4096416)
Affinity DataKi:  0.820nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231962(CHEMBL4099379)
Affinity DataKi:  0.840nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231896(CHEMBL4084829)
Affinity DataKi:  0.940nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231895(CHEMBL4073486)
Affinity DataKi:  1.10nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231947(CHEMBL4062134)
Affinity DataKi:  1.40nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231948(CHEMBL4066463)
Affinity DataKi:  1.40nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231898(CHEMBL4079909)
Affinity DataKi:  1.5nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231899(CHEMBL4087789)
Affinity DataKi:  1.70nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231886(CHEMBL4070761)
Affinity DataKi:  10nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231946(CHEMBL4086317)
Affinity DataKi:  16nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231897(CHEMBL4102787)
Affinity DataKi:  18nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231901(CHEMBL4088708)
Affinity DataKi:  26nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231881(CHEMBL4063807)
Affinity DataKi:  34nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231964(CHEMBL4066546)
Affinity DataKi: >50nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231885(CHEMBL4104225)
Affinity DataKi: >50nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231963(CHEMBL4104146)
Affinity DataKi: >50nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231884(CHEMBL4094078)
Affinity DataKi: >50nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231882(CHEMBL4075157)
Affinity DataKi: >50nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231944(CHEMBL4072398)
Affinity DataKi: >50nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231883(CHEMBL4101821)
Affinity DataKi: >50nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProteinase-activated receptor 2(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50440863(CHEMBL2431716)
Affinity DataIC50:  100nMAssay Description:Agonist activity at human PAR2 expressed in CHO cells assessed as inhibition of forskolin-induced cAMP accumulation incubated for 20 mins followed by...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProteinase-activated receptor 2(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50440863(CHEMBL2431716)
Affinity DataIC50:  109nMAssay Description:Agonist activity at human PAR2 expressed in CHO cells assessed as inhibition of forskolin-induced cAMP accumulation incubated for 20 mins followed by...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProteinase-activated receptor 2(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50440862(CHEMBL2431717)
Affinity DataIC50:  500nMAssay Description:Antagonist activity at PAR2 in human HT-29 cells assessed as inhibition of 2f-LIGRLO-NH2-induced ca2+ release preincubated for 15 mins measured after...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProteinase-activated receptor 2(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50440862(CHEMBL2431717)
Affinity DataIC50:  501nMAssay Description:Antagonist activity at PAR2 in human HT-29 cells assessed as inhibition of 2f-LIGRLO-NH2-induced ca2+ release preincubated for 15 mins measured after...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProteinase-activated receptor 2(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50440863(CHEMBL2431716)
Affinity DataIC50:  700nMAssay Description:Antagonist activity at PAR2 in human HT-29 cells assessed as inhibition of 2f-LIGRLO-NH2-stimulated intracellular calcium release preincubated for 30...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProteinase-activated receptor 2(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50440863(CHEMBL2431716)
Affinity DataIC50:  700nMAssay Description:Antagonist activity at PAR2 in human HT-29 cells assessed as inhibition of 2f-LIGRLO-NH2-stimulated intracellular calcium release preincubated for 30...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProteinase-activated receptor 2(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50440868(CHEMBL2431617)
Affinity DataIC50:  1.10E+3nMAssay Description:Antagonist activity at PAR2 in human HT-29 cells assessed as inhibition of 2f-LIGRLO-NH2-stimulated intracellular calcium release preincubated for 30...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProteinase-activated receptor 2(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50440868(CHEMBL2431617)
Affinity DataIC50:  1.10E+3nMAssay Description:Antagonist activity at PAR2 in human HT-29 cells assessed as inhibition of 2f-LIGRLO-NH2-stimulated intracellular calcium release preincubated for 30...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProteinase-activated receptor 2(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50203292(CHEMBL3902670)
Affinity DataIC50:  1.20E+3nMAssay Description:Antagonist activity at PAR2 in human HT-29 cells assessed as inhibition of 2f-LIGRLO-NH2-stimulated intracellular calcium release preincubated for 30...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProteinase-activated receptor 2(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50138043(CHEMBL3752235)
Affinity DataIC50:  1.25E+3nMAssay Description:Antagonist activity at PAR2 in human HT-29 cells assessed as inhibition of 2f-LIGRLO-NH2-induced ca2+ release preincubated for 15 mins measured after...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProteinase-activated receptor 2(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50440868(CHEMBL2431617)
Affinity DataIC50:  1.25E+3nMAssay Description:Antagonist activity at PAR2 in human HT-29 cells assessed as inhibition of 2f-LIGRLO-NH2-induced ca2+ release preincubated for 15 mins measured after...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProteinase-activated receptor 2(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50138043(CHEMBL3752235)
Affinity DataIC50:  1.26E+3nMAssay Description:Antagonist activity at PAR2 in human HT-29 cells assessed as inhibition of 2f-LIGRLO-NH2-induced ca2+ release preincubated for 15 mins measured after...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProteinase-activated receptor 2(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50203292(CHEMBL3902670)
Affinity DataIC50:  1.26E+3nMAssay Description:Antagonist activity at PAR2 in human HT-29 cells assessed as inhibition of 2f-LIGRLO-NH2-stimulated intracellular calcium release preincubated for 30...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProteinase-activated receptor 2(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50440868(CHEMBL2431617)
Affinity DataIC50:  1.26E+3nMAssay Description:Antagonist activity at PAR2 in human HT-29 cells assessed as inhibition of 2f-LIGRLO-NH2-induced ca2+ release preincubated for 15 mins measured after...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProteinase-activated receptor 2(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50440862(CHEMBL2431717)
Affinity DataIC50:  1.90E+3nMAssay Description:Antagonist activity at PAR2 in human HT-29 cells assessed as inhibition of trypsin-induced ca2+ release preincubated for 15 mins measured after 1 hr ...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProteinase-activated receptor 2(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50203296(CHEMBL3959120)
Affinity DataIC50:  1.90E+3nMAssay Description:Antagonist activity at PAR2 in human HT-29 cells assessed as inhibition of 2f-LIGRLO-NH2-stimulated intracellular calcium release preincubated for 30...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProteinase-activated receptor 2(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50440862(CHEMBL2431717)
Affinity DataIC50:  2.00E+3nMAssay Description:Antagonist activity at PAR2 in human HT-29 cells assessed as inhibition of trypsin-induced ca2+ release preincubated for 15 mins measured after 1 hr ...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProteinase-activated receptor 2(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50203296(CHEMBL3959120)
Affinity DataIC50:  2.00E+3nMAssay Description:Antagonist activity at PAR2 in human HT-29 cells assessed as inhibition of 2f-LIGRLO-NH2-stimulated intracellular calcium release preincubated for 30...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProteinase-activated receptor 2(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50440863(CHEMBL2431716)
Affinity DataIC50:  2.20E+3nMAssay Description:Antagonist activity at PAR2 in human HT-29 cells assessed as inhibition of endogenous trypsin-stimulated intracellular calcium release by Fluo-3 AM d...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProteinase-activated receptor 2(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50203291(CHEMBL3916411)
Affinity DataIC50:  3.10E+3nMAssay Description:Antagonist activity at PAR2 in human HT-29 cells assessed as inhibition of 2f-LIGRLO-NH2-stimulated intracellular calcium release preincubated for 30...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProteinase-activated receptor 2(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50203291(CHEMBL3916411)
Affinity DataIC50:  3.16E+3nMAssay Description:Antagonist activity at PAR2 in human HT-29 cells assessed as inhibition of 2f-LIGRLO-NH2-stimulated intracellular calcium release preincubated for 30...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Displayed 1 to 50 (of 148 total ) | Next | Last >>
Jump to: