TargetLysine-specific histone demethylase 1A(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataKi: 6.10nMAssay Description:Time dependant inhibition of recombinant N-terminal His-tagged LSD1 (unknown origin) expressed in Escherichia coli expression system assessed as inhi...More data for this Ligand-Target Pair
TargetLysine-specific histone demethylase 1A(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataKi: 9.60nMAssay Description:Time dependant inhibition of recombinant N-terminal His-tagged LSD1 (unknown origin) expressed in Escherichia coli expression system assessed as inhi...More data for this Ligand-Target Pair
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: <1nMAssay Description:Inhibition of wild-type EZH2 in PRC2 complex (unknown origin) using RKQLATKAARK(Me3)SAPATGGVKKP-NH2 peptide substrate preincubated for 30 mins follow...More data for this Ligand-Target Pair
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: <1nMAssay Description:Inhibition of wild-type EZH2 in PRC2 complex (unknown origin) using RKQLATKAARK(Me3)SAPATGGVKKP-NH2 peptide substrate preincubated for 30 mins follow...More data for this Ligand-Target Pair
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: <1nMAssay Description:Inhibition of wild-type EZH2 in PRC2 complex (unknown origin) using RKQLATKAARK(Me3)SAPATGGVKKP-NH2 peptide substrate preincubated for 30 mins follow...More data for this Ligand-Target Pair
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: <1nMAssay Description:Inhibition of wild-type EZH2 in PRC2 complex (unknown origin) using RKQLATKAARK(Me3)SAPATGGVKKP-NH2 peptide substrate preincubated for 30 mins follow...More data for this Ligand-Target Pair
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: <1nMAssay Description:Inhibition of EZH2 Y641F mutant in PRC2 complex (unknown origin) using RKQLATKAARK(Me3)SAPATGGVKKP-NH2 peptide substrate preincubated for 30 mins fol...More data for this Ligand-Target Pair
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: <1nMAssay Description:Inhibition of wild-type EZH2 in PRC2 complex (unknown origin) using RKQLATKAARK(Me3)SAPATGGVKKP-NH2 peptide substrate preincubated for 30 mins follow...More data for this Ligand-Target Pair
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: <1nMAssay Description:Inhibition of wild-type EZH2 in PRC2 complex (unknown origin) using RKQLATKAARK(Me3)SAPATGGVKKP-NH2 peptide substrate preincubated for 30 mins follow...More data for this Ligand-Target Pair
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of EZH2 Y641N mutant (unknown origin) using biotinylated nucleosome, H3K27me3 activator and [3H]-SAM incubated for 60 mins by top-count ba...More data for this Ligand-Target Pair
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of EZH2 (unknown origin) using biotinylated nucleosome, H3K27me3 activator and [3H]-SAM incubated for 60 mins by top-count based methodMore data for this Ligand-Target Pair
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of EZH2 (unknown origin) using biotinylated nucleosome, H3K27me3 activator and [3H]-SAM incubated for 60 mins by top-count based methodMore data for this Ligand-Target Pair
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of EZH2 (unknown origin) using biotinylated nucleosome, H3K27me3 activator and [3H]-SAM incubated for 60 mins by top-count based methodMore data for this Ligand-Target Pair
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: <1nMAssay Description:Inhibition of EZH2 (unknown origin) using biotinylated nucleosome, H3K27me3 activator and [3H]-SAM incubated for 60 mins by top-count based methodMore data for this Ligand-Target Pair
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: 1.60nMAssay Description:Inhibition of wild-type EZH2 in PRC2 complex (unknown origin) using RKQLATKAARK(Me3)SAPATGGVKKP-NH2 peptide substrate preincubated for 30 mins follow...More data for this Ligand-Target Pair
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: 1.70nMAssay Description:Inhibition of EZH2 Y641F mutant in PRC2 complex (unknown origin) using RKQLATKAARK(Me3)SAPATGGVKKP-NH2 peptide substrate preincubated for 30 mins fol...More data for this Ligand-Target Pair
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: 1.70nMAssay Description:Inhibition of EZH2 Y641F mutant in PRC2 complex (unknown origin) using RKQLATKAARK(Me3)SAPATGGVKKP-NH2 peptide substrate preincubated for 30 mins fol...More data for this Ligand-Target Pair
TargetLysine-specific histone demethylase 1A(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: <1.80nMAssay Description:Inhibition of recombinant N-terminal His-tagged LSD1 (unknown origin) expressed in Escherichia coli expression system using ART-K(Me1)-QTARKSTGGKAPRK...More data for this Ligand-Target Pair
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: 1.80nMAssay Description:Inhibition of wild-type EZH2 in PRC2 complex (unknown origin) using RKQLATKAARK(Me3)SAPATGGVKKP-NH2 peptide substrate preincubated for 30 mins follow...More data for this Ligand-Target Pair
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: 2nMAssay Description:Inhibition of wild-type EZH2 in PRC2 complex (unknown origin) using RKQLATKAARK(Me3)SAPATGGVKKP-NH2 peptide substrate preincubated for 30 mins follow...More data for this Ligand-Target Pair
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: 2nMAssay Description:Inhibition of EZH2 Y641N mutant (unknown origin) using biotinylated nucleosome, H3K27me3 activator and [3H]-SAM incubated for 60 mins by top-count ba...More data for this Ligand-Target Pair
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: 2nMAssay Description:Inhibition of EZH2 (unknown origin) using biotinylated nucleosome, H3K27me3 activator and [3H]-SAM incubated for 60 mins by top-count based methodMore data for this Ligand-Target Pair
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: 2nMAssay Description:Inhibition of EZH2 (unknown origin) using biotinylated nucleosome, H3K27me3 activator and [3H]-SAM incubated for 60 mins by top-count based methodMore data for this Ligand-Target Pair
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: 2nMAssay Description:Inhibition of EZH2 (unknown origin) using biotinylated nucleosome, H3K27me3 activator and [3H]-SAM incubated for 60 mins by top-count based methodMore data for this Ligand-Target Pair
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: 2.20nMAssay Description:Inhibition of wild-type EZH2 in PRC2 complex (unknown origin) using RKQLATKAARK(Me3)SAPATGGVKKP-NH2 peptide substrate preincubated for 30 mins follow...More data for this Ligand-Target Pair
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: 2.30nMAssay Description:Inhibition of wild-type EZH2 in PRC2 complex (unknown origin) using RKQLATKAARK(Me3)SAPATGGVKKP-NH2 peptide substrate preincubated for 30 mins follow...More data for this Ligand-Target Pair
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: 2.5nMAssay Description:Inhibition of wild-type EZH2 in PRC2 complex (unknown origin) using RKQLATKAARK(Me3)SAPATGGVKKP-NH2 peptide substrate preincubated for 30 mins follow...More data for this Ligand-Target Pair
Affinity DataIC50: 2.5nMAssay Description:Histidine-Flag-PB1-BD5 Bromodomain645-766 (S645-D766; Swiss Prot Q86U86; mhhhhhhasdykddddkgslvpr\gsSGISPKKSKYMTPMQQKLNEVYEAVKNYTDKRGRRLSAI FLRLPSRSEL...More data for this Ligand-Target Pair
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: 2.5nMAssay Description:Inhibition of EZH2 Y641F mutant in PRC2 complex (unknown origin) using RKQLATKAARK(Me3)SAPATGGVKKP-NH2 peptide substrate preincubated for 30 mins fol...More data for this Ligand-Target Pair
TargetLysine-specific histone demethylase 1A(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: 2.60nMAssay Description:Inhibition of recombinant N-terminal His-tagged LSD1 (unknown origin) expressed in Escherichia coli expression system using ART-K(Me1)-QTARKSTGGKAPRK...More data for this Ligand-Target Pair
TargetReverse transcriptase(Human immunodeficiency virus 1)
Boehringer Ingelheim (Canada)
Curated by ChEMBL
Boehringer Ingelheim (Canada)
Curated by ChEMBL
Affinity DataIC50: 2.60nMAssay Description:Inhibition of HIV1 reverse transcriptase using poly(rA)/oligo(dT)15 as substrate after 60 mins by fluorescence assayMore data for this Ligand-Target Pair
TargetReverse transcriptase(Human immunodeficiency virus 1)
Boehringer Ingelheim (Canada)
Curated by ChEMBL
Boehringer Ingelheim (Canada)
Curated by ChEMBL
Affinity DataIC50: 2.60nMAssay Description:Inhibition of HIV1 reverse transcriptase using poly(rA)/oligo(dT)15 as substrate after 60 mins by fluorescence assayMore data for this Ligand-Target Pair
TargetLysine-specific histone demethylase 1A(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: <2.60nMAssay Description:Inhibition of recombinant N-terminal His-tagged LSD1 (unknown origin) expressed in Escherichia coli expression system using ART-K(Me1)-QTARKSTGGKAPRK...More data for this Ligand-Target Pair
TargetLysine-specific histone demethylase 1A(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: <2.80nMAssay Description:Inhibition of recombinant N-terminal His-tagged LSD1 (unknown origin) expressed in Escherichia coli expression system using ART-K(Me1)-QTARKSTGGKAPRK...More data for this Ligand-Target Pair
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: 2.80nMAssay Description:Inhibition of EZH2 Y641F mutant in PRC2 complex (unknown origin) using RKQLATKAARK(Me3)SAPATGGVKKP-NH2 peptide substrate preincubated for 30 mins fol...More data for this Ligand-Target Pair
TargetLysine-specific histone demethylase 1A(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: 2.90nMAssay Description:Inhibition of recombinant N-terminal His-tagged LSD1 (unknown origin) expressed in Escherichia coli expression system using ART-K(Me1)-QTARKSTGGKAPRK...More data for this Ligand-Target Pair
TargetReverse transcriptase(Human immunodeficiency virus 1)
Boehringer Ingelheim (Canada)
Curated by ChEMBL
Boehringer Ingelheim (Canada)
Curated by ChEMBL
Affinity DataIC50: 2.90nMAssay Description:Inhibition of HIV1 reverse transcriptase using poly(rA)/oligo(dT)15 as substrate after 60 mins by fluorescence assayMore data for this Ligand-Target Pair
TargetLysine-specific histone demethylase 1A(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: <3nMAssay Description:Inhibition of recombinant N-terminal His-tagged LSD1 (unknown origin) expressed in Escherichia coli expression system using ART-K(Me1)-QTARKSTGGKAPRK...More data for this Ligand-Target Pair
TargetLysine-specific histone demethylase 1A(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: 3nMAssay Description:Inhibition of recombinant N-terminal His-tagged LSD1 (unknown origin) expressed in Escherichia coli expression system using ART-K(Me1)-QTARKSTGGKAPRK...More data for this Ligand-Target Pair
TargetLysine-specific histone demethylase 1A(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: <3nMAssay Description:Inhibition of recombinant N-terminal His-tagged LSD1 (unknown origin) expressed in Escherichia coli expression system using ART-K(Me1)-QTARKSTGGKAPRK...More data for this Ligand-Target Pair
TargetLysine-specific histone demethylase 1A(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: <3nMAssay Description:Inhibition of recombinant N-terminal His-tagged LSD1 (unknown origin) expressed in Escherichia coli expression system using ART-K(Me1)-QTARKSTGGKAPRK...More data for this Ligand-Target Pair
TargetReverse transcriptase(Human immunodeficiency virus 1)
Boehringer Ingelheim (Canada)
Curated by ChEMBL
Boehringer Ingelheim (Canada)
Curated by ChEMBL
Affinity DataIC50: 3nMAssay Description:Inhibition of HIV1 reverse transcriptase using poly(rA)/oligo(dT)15 as substrate after 60 mins by fluorescence assayMore data for this Ligand-Target Pair
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: 3nMAssay Description:Inhibition of EZH2 Y641N mutant (unknown origin) using biotinylated nucleosome, H3K27me3 activator and [3H]-SAM incubated for 60 mins by top-count ba...More data for this Ligand-Target Pair
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: 3nMAssay Description:Inhibition of EZH2 Y641N mutant (unknown origin) using biotinylated nucleosome, H3K27me3 activator and [3H]-SAM incubated for 60 mins by top-count ba...More data for this Ligand-Target Pair
TargetReverse transcriptase(Human immunodeficiency virus 1)
Boehringer Ingelheim (Canada)
Curated by ChEMBL
Boehringer Ingelheim (Canada)
Curated by ChEMBL
Affinity DataIC50: 3.10nMAssay Description:Inhibition of HIV1 reverse transcriptase using poly(rA)/oligo(dT)15 as substrate after 60 mins by fluorescence assayMore data for this Ligand-Target Pair
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: 3.10nMAssay Description:Inhibition of EZH2 Y641F mutant in PRC2 complex (unknown origin) using RKQLATKAARK(Me3)SAPATGGVKKP-NH2 peptide substrate preincubated for 30 mins fol...More data for this Ligand-Target Pair
TargetReverse transcriptase(Human immunodeficiency virus 1)
Boehringer Ingelheim (Canada)
Curated by ChEMBL
Boehringer Ingelheim (Canada)
Curated by ChEMBL
Affinity DataIC50: 3.20nMAssay Description:Inhibition of HIV1 reverse transcriptase using poly(rA)/oligo(dT)15 as substrate after 60 mins by fluorescence assayMore data for this Ligand-Target Pair
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: 3.30nMAssay Description:Inhibition of wild-type EZH2 in PRC2 complex (unknown origin) using RKQLATKAARK(Me3)SAPATGGVKKP-NH2 peptide substrate preincubated for 30 mins follow...More data for this Ligand-Target Pair
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Constellation Pharmaceuticals
Curated by ChEMBL
Constellation Pharmaceuticals
Curated by ChEMBL
Affinity DataIC50: 3.30nMAssay Description:Inhibition of EZH2 Y641F mutant in PRC2 complex (unknown origin) using RKQLATKAARK(Me3)SAPATGGVKKP-NH2 peptide substrate preincubated for 30 mins fol...More data for this Ligand-Target Pair
Affinity DataIC50: 3.40nMAssay Description:His-BRG1 (A1448-S1575; Swiss Prot P51532; mhhhhhhgslvpr\gsAEKLSPNPP NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNH KYRSLNDLEKDVMLLCQNA...More data for this Ligand-Target Pair