Compile Data Set for Download or QSAR
maximum 50k data
Found 161 with Last Name = 'mitchell' and Initial = 'jm'
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231952(CHEMBL4081554)
Affinity DataKi:  0.110nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231900(CHEMBL4060480)
Affinity DataKi:  0.230nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50261506(CHEMBL499930 | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-NH2)
Affinity DataKi:  0.320nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231888(CHEMBL4081357)
Affinity DataKi:  0.350nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231942(CHEMBL4065403)
Affinity DataKi:  0.470nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231943(CHEMBL4093072)
Affinity DataKi:  0.490nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231949(CHEMBL4069162)
Affinity DataKi:  0.490nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231887(CHEMBL4091638)
Affinity DataKi:  0.520nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50086603(CHEMBL3426241)
Affinity DataKi:  0.570nMAssay Description:Displacement of [125I]-17 from human GLP-1R expressed in CHO cell membranes incubated for 120 mins by scintillation counting based radioligand bindin...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50301953((3S,6S,9S,12S,15S,21S)-21-(2-((S)-2-amino-3-(1H-im...)
Affinity DataKi:  0.660nMAssay Description:Displacement of [125I]-17 from human GLP-1R expressed in CHO cell membranes incubated for 120 mins by scintillation counting based radioligand bindin...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231894(CHEMBL4100325)
Affinity DataKi:  0.800nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231902(CHEMBL4096416)
Affinity DataKi:  0.820nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231962(CHEMBL4099379)
Affinity DataKi:  0.840nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231896(CHEMBL4084829)
Affinity DataKi:  0.940nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231895(CHEMBL4073486)
Affinity DataKi:  1.10nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231947(CHEMBL4062134)
Affinity DataKi:  1.40nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231948(CHEMBL4066463)
Affinity DataKi:  1.40nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231898(CHEMBL4079909)
Affinity DataKi:  1.5nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231899(CHEMBL4087789)
Affinity DataKi:  1.70nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50086602(CHEMBL3426300)
Affinity DataKi:  6nMAssay Description:Displacement of [125I]-17 from human GLP-1R expressed in CHO cell membranes incubated for 120 mins by scintillation counting based radioligand bindin...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231886(CHEMBL4070761)
Affinity DataKi:  10nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231946(CHEMBL4086317)
Affinity DataKi:  16nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50086588(CHEMBL3426243)
Affinity DataKi:  17nMAssay Description:Displacement of [125I]-17 from human GLP-1R expressed in CHO cell membranes incubated for 120 mins by scintillation counting based radioligand bindin...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231897(CHEMBL4102787)
Affinity DataKi:  18nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231901(CHEMBL4088708)
Affinity DataKi:  26nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231881(CHEMBL4063807)
Affinity DataKi:  34nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50086599(CHEMBL3426297)
Affinity DataKi:  41nMAssay Description:Displacement of [125I]-17 from human GLP-1R expressed in CHO cell membranes incubated for 120 mins by scintillation counting based radioligand bindin...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231964(CHEMBL4066546)
Affinity DataKi: >50nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231944(CHEMBL4072398)
Affinity DataKi: >50nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231884(CHEMBL4094078)
Affinity DataKi: >50nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231963(CHEMBL4104146)
Affinity DataKi: >50nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231885(CHEMBL4104225)
Affinity DataKi: >50nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231883(CHEMBL4101821)
Affinity DataKi: >50nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231882(CHEMBL4075157)
Affinity DataKi: >50nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50086587(CHEMBL3426242)
Affinity DataKi:  59nMAssay Description:Displacement of [125I]-17 from human GLP-1R expressed in CHO cell membranes incubated for 120 mins by scintillation counting based radioligand bindin...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50086598(CHEMBL3426296)
Affinity DataKi:  130nMAssay Description:Displacement of [125I]-17 from human GLP-1R expressed in CHO cell membranes incubated for 120 mins by scintillation counting based radioligand bindin...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50086589(CHEMBL3426244)
Affinity DataKi:  300nMAssay Description:Displacement of [125I]-17 from human GLP-1R expressed in CHO cell membranes incubated for 120 mins by scintillation counting based radioligand bindin...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50086591(CHEMBL3426246)
Affinity DataKi:  320nMAssay Description:Displacement of [125I]-17 from human GLP-1R expressed in CHO cell membranes incubated for 120 mins by scintillation counting based radioligand bindin...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50086595(CHEMBL3426293)
Affinity DataKi:  550nMAssay Description:Displacement of [125I]-17 from human GLP-1R expressed in CHO cell membranes incubated for 120 mins by scintillation counting based radioligand bindin...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50086594(CHEMBL3426292)
Affinity DataKi:  980nMAssay Description:Displacement of [125I]-17 from human GLP-1R expressed in CHO cell membranes incubated for 120 mins by scintillation counting based radioligand bindin...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50086590(CHEMBL3426245)
Affinity DataKi:  1.20E+3nMAssay Description:Displacement of [125I]-17 from human GLP-1R expressed in CHO cell membranes incubated for 120 mins by scintillation counting based radioligand bindin...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50086601(CHEMBL3426299)
Affinity DataKi:  1.70E+3nMAssay Description:Displacement of [125I]-17 from human GLP-1R expressed in CHO cell membranes incubated for 120 mins by scintillation counting based radioligand bindin...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50086593(CHEMBL3426291)
Affinity DataKi:  2.40E+3nMAssay Description:Displacement of [125I]-17 from human GLP-1R expressed in CHO cell membranes incubated for 120 mins by scintillation counting based radioligand bindin...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50086600(CHEMBL3426298)
Affinity DataKi:  3.00E+3nMAssay Description:Displacement of [125I]-17 from human GLP-1R expressed in CHO cell membranes incubated for 120 mins by scintillation counting based radioligand bindin...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50086592(CHEMBL3426247)
Affinity DataKi: >3.10E+3nMAssay Description:Displacement of [125I]-17 from human GLP-1R expressed in CHO cell membranes incubated for 120 mins by scintillation counting based radioligand bindin...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50086597(CHEMBL3426295)
Affinity DataKi:  4.80E+3nMAssay Description:Displacement of [125I]-17 from human GLP-1R expressed in CHO cell membranes incubated for 120 mins by scintillation counting based radioligand bindin...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50086596(CHEMBL3426294)
Affinity DataKi: >8.00E+3nMAssay Description:Displacement of [125I]-17 from human GLP-1R expressed in CHO cell membranes incubated for 120 mins by scintillation counting based radioligand bindin...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50301953((3S,6S,9S,12S,15S,21S)-21-(2-((S)-2-amino-3-(1H-im...)
Affinity DataEC50:  0.190nMAssay Description:Agonist activity at human GLP-1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 minsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50086603(CHEMBL3426241)
Affinity DataEC50:  0.120nMAssay Description:Agonist activity at human GLP-1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 minsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50086587(CHEMBL3426242)
Affinity DataEC50:  68nMAssay Description:Agonist activity at human GLP-1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 minsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Displayed 1 to 50 (of 161 total ) | Next | Last >>
Jump to: