Compile Data Set for Download or QSAR
maximum 50k data
Found 311 with Last Name = 'stanton' and Initial = 'r'
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231952(CHEMBL4081554)
Affinity DataKi:  0.110nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231900(CHEMBL4060480)
Affinity DataKi:  0.230nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50261506(CHEMBL499930 | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-NH2)
Affinity DataKi:  0.320nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231888(CHEMBL4081357)
Affinity DataKi:  0.350nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231942(CHEMBL4065403)
Affinity DataKi:  0.470nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231943(CHEMBL4093072)
Affinity DataKi:  0.490nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231949(CHEMBL4069162)
Affinity DataKi:  0.490nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231887(CHEMBL4091638)
Affinity DataKi:  0.520nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50086603(CHEMBL3426241)
Affinity DataKi:  0.570nMAssay Description:Displacement of [125I]-17 from human GLP-1R expressed in CHO cell membranes incubated for 120 mins by scintillation counting based radioligand bindin...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCoagulation factor VII(Homo sapiens (Human))
Bristol-Myers Squibb Pharmaceutical Research Institute

Curated by ChEMBL
LigandPNGBDBM50437440(CHEMBL2409219)
Affinity DataKi:  0.620nMAssay Description:Inhibition of recombinant human coagulation factor 7AMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50301953((3S,6S,9S,12S,15S,21S)-21-(2-((S)-2-amino-3-(1H-im...)
Affinity DataKi:  0.660nMAssay Description:Displacement of [125I]-17 from human GLP-1R expressed in CHO cell membranes incubated for 120 mins by scintillation counting based radioligand bindin...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231894(CHEMBL4100325)
Affinity DataKi:  0.800nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231902(CHEMBL4096416)
Affinity DataKi:  0.820nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231962(CHEMBL4099379)
Affinity DataKi:  0.840nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231896(CHEMBL4084829)
Affinity DataKi:  0.940nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231895(CHEMBL4073486)
Affinity DataKi:  1.10nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231948(CHEMBL4066463)
Affinity DataKi:  1.40nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231947(CHEMBL4062134)
Affinity DataKi:  1.40nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231898(CHEMBL4079909)
Affinity DataKi:  1.5nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231899(CHEMBL4087789)
Affinity DataKi:  1.70nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCoagulation factor VII(Homo sapiens (Human))
Bristol-Myers Squibb Pharmaceutical Research Institute

Curated by ChEMBL
LigandPNGBDBM50437438(CHEMBL2409314)
Affinity DataKi:  1.90nMAssay Description:Inhibition of recombinant human coagulation factor 7AMore data for this Ligand-Target Pair
TargetProstaglandin E2 receptor EP3 subtype(Homo sapiens (Human))
Pfizer

US Patent
LigandPNGBDBM50095296(CHEMBL3589082 | US9278953, 1)
Affinity DataKi:  2nM ΔG°:  -49.7kJ/molepH: 7.4 T: 2°CAssay Description:Test compounds were half log serially diluted in 100% DMSO (J. T. Baker #922401). 1 uL of each compound was added to appropriate wells of a 384-well ...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetProstaglandin E2 receptor EP3 subtype(Homo sapiens (Human))
Pfizer

US Patent
LigandPNGBDBM335698((R)-3-(3-Methyl-2-oxopiperidin-3-yl)-6-(5-methylqu...)
Affinity DataKi:  3.30nMAssay Description:To measure the ability of test compounds in the present invention to bind to the human EP3 receptor, and therefore have the potential to antagonize P...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetProstaglandin E2 receptor EP3 subtype(Homo sapiens (Human))
Pfizer

US Patent
LigandPNGBDBM50095295(CHEMBL3589083 | US9278953, 2)
Affinity DataKi:  3.60nM ΔG°:  -48.2kJ/molepH: 7.4 T: 2°CAssay Description:Test compounds were half log serially diluted in 100% DMSO (J. T. Baker #922401). 1 uL of each compound was added to appropriate wells of a 384-well ...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetProstaglandin E2 receptor EP3 subtype(Homo sapiens (Human))
Pfizer

US Patent
LigandPNGBDBM335700((R)-6-(5-Ethylquinolin-7-yl)-3-(3-methyl-2-oxopipe...)
Affinity DataKi:  4.60nMAssay Description:To measure the ability of test compounds in the present invention to bind to the human EP3 receptor, and therefore have the potential to antagonize P...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50086602(CHEMBL3426300)
Affinity DataKi:  6nMAssay Description:Displacement of [125I]-17 from human GLP-1R expressed in CHO cell membranes incubated for 120 mins by scintillation counting based radioligand bindin...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProstaglandin E2 receptor EP3 subtype(Homo sapiens (Human))
Pfizer

US Patent
LigandPNGBDBM335699((R)-3-(3-Methyl-2-oxopiperidin-3-yl)-6-(5-methylqu...)
Affinity DataKi:  7.20nMAssay Description:To measure the ability of test compounds in the present invention to bind to the human EP3 receptor, and therefore have the potential to antagonize P...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetProstaglandin E2 receptor EP3 subtype(Homo sapiens (Human))
Pfizer

US Patent
LigandPNGBDBM335702((R)-6-(5-Cyclopropylquinolin-7-yl)-3-(3-methyl-2-o...)
Affinity DataKi:  7.30nMAssay Description:To measure the ability of test compounds in the present invention to bind to the human EP3 receptor, and therefore have the potential to antagonize P...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetProstaglandin E2 receptor EP3 subtype(Homo sapiens (Human))
Pfizer

US Patent
LigandPNGBDBM50095294(CHEMBL3589084 | US9278953, 7)
Affinity DataKi:  7.80nM ΔG°:  -46.3kJ/molepH: 7.4 T: 2°CAssay Description:Test compounds were half log serially diluted in 100% DMSO (J. T. Baker #922401). 1 uL of each compound was added to appropriate wells of a 384-well ...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetCoagulation factor VII(Homo sapiens (Human))
Bristol-Myers Squibb Pharmaceutical Research Institute

Curated by ChEMBL
LigandPNGBDBM50437439(CHEMBL2409220)
Affinity DataKi:  8.10nMAssay Description:Inhibition of recombinant human coagulation factor 7AMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProstaglandin E2 receptor EP3 subtype(Homo sapiens (Human))
Pfizer

US Patent
LigandPNGBDBM335701((R)-6-(5-Chloroquinolin-7-yl)-3-(3-methyl-2-oxopip...)
Affinity DataKi:  8.90nMAssay Description:To measure the ability of test compounds in the present invention to bind to the human EP3 receptor, and therefore have the potential to antagonize P...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetProstaglandin E2 receptor EP3 subtype(Homo sapiens (Human))
Pfizer

US Patent
LigandPNGBDBM212596(US9278953, 3)
Affinity DataKi:  9.5nM ΔG°:  -45.8kJ/molepH: 7.4 T: 2°CAssay Description:Test compounds were half log serially diluted in 100% DMSO (J. T. Baker #922401). 1 uL of each compound was added to appropriate wells of a 384-well ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231886(CHEMBL4070761)
Affinity DataKi:  10nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProstaglandin E2 receptor EP3 subtype(Homo sapiens (Human))
Pfizer

US Patent
LigandPNGBDBM212598(US9278953, 4)
Affinity DataKi:  11.2nM ΔG°:  -45.4kJ/molepH: 7.4 T: 2°CAssay Description:Test compounds were half log serially diluted in 100% DMSO (J. T. Baker #922401). 1 uL of each compound was added to appropriate wells of a 384-well ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetProstaglandin E2 receptor EP3 subtype(Homo sapiens (Human))
Pfizer

US Patent
LigandPNGBDBM212605(US9278953, 9)
Affinity DataKi:  11.9nM ΔG°:  -45.2kJ/molepH: 7.4 T: 2°CAssay Description:Test compounds were half log serially diluted in 100% DMSO (J. T. Baker #922401). 1 uL of each compound was added to appropriate wells of a 384-well ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetProstaglandin E2 receptor EP3 subtype(Homo sapiens (Human))
Pfizer

US Patent
LigandPNGBDBM212600(US9278953, 5)
Affinity DataKi:  12.2nM ΔG°:  -45.2kJ/molepH: 7.4 T: 2°CAssay Description:Test compounds were half log serially diluted in 100% DMSO (J. T. Baker #922401). 1 uL of each compound was added to appropriate wells of a 384-well ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetProstaglandin E2 receptor EP3 subtype(Homo sapiens (Human))
Pfizer

US Patent
LigandPNGBDBM212607(US9278953, 11)
Affinity DataKi:  13.9nM ΔG°:  -44.8kJ/molepH: 7.4 T: 2°CAssay Description:Test compounds were half log serially diluted in 100% DMSO (J. T. Baker #922401). 1 uL of each compound was added to appropriate wells of a 384-well ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetProstaglandin E2 receptor EP3 subtype(Homo sapiens (Human))
Pfizer

US Patent
LigandPNGBDBM212604(US9278953, 8)
Affinity DataKi:  14.2nM ΔG°:  -44.8kJ/molepH: 7.4 T: 2°CAssay Description:Test compounds were half log serially diluted in 100% DMSO (J. T. Baker #922401). 1 uL of each compound was added to appropriate wells of a 384-well ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetCoagulation factor X(Homo sapiens (Human))
Bristol-Myers Squibb Pharmaceutical Research Institute

Curated by ChEMBL
LigandPNGBDBM50437440(CHEMBL2409219)
Affinity DataKi:  16nMAssay Description:Inhibition of purified human coagulation factor 10aMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231946(CHEMBL4086317)
Affinity DataKi:  16nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50086588(CHEMBL3426243)
Affinity DataKi:  17nMAssay Description:Displacement of [125I]-17 from human GLP-1R expressed in CHO cell membranes incubated for 120 mins by scintillation counting based radioligand bindin...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231897(CHEMBL4102787)
Affinity DataKi:  18nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProstaglandin E2 receptor EP3 subtype(Homo sapiens (Human))
Pfizer

US Patent
LigandPNGBDBM335704((R)-3-(3-Methyl-2-oxopyrrolidin-3-yl)-6-(5-methylq...)
Affinity DataKi:  18.6nMAssay Description:To measure the ability of test compounds in the present invention to bind to the human EP3 receptor, and therefore have the potential to antagonize P...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetProstaglandin E2 receptor EP3 subtype(Homo sapiens (Human))
Pfizer

US Patent
LigandPNGBDBM212606(US9278953, 10)
Affinity DataKi:  19.9nM ΔG°:  -44.0kJ/molepH: 7.4 T: 2°CAssay Description:Test compounds were half log serially diluted in 100% DMSO (J. T. Baker #922401). 1 uL of each compound was added to appropriate wells of a 384-well ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetProstaglandin E2 receptor EP3 subtype(Homo sapiens (Human))
Pfizer

US Patent
LigandPNGBDBM212608(US9278953, 12)
Affinity DataKi:  25nM ΔG°:  -43.4kJ/molepH: 7.4 T: 2°CAssay Description:Test compounds were half log serially diluted in 100% DMSO (J. T. Baker #922401). 1 uL of each compound was added to appropriate wells of a 384-well ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231901(CHEMBL4088708)
Affinity DataKi:  26nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProstaglandin E2 receptor EP3 subtype(Homo sapiens (Human))
Pfizer

US Patent
LigandPNGBDBM212609(US9278953, 14)
Affinity DataKi:  29.2nM ΔG°:  -43.0kJ/molepH: 7.4 T: 2°CAssay Description:Test compounds were half log serially diluted in 100% DMSO (J. T. Baker #922401). 1 uL of each compound was added to appropriate wells of a 384-well ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetProstaglandin E2 receptor EP3 subtype(Homo sapiens (Human))
Pfizer

US Patent
LigandPNGBDBM50095293(CHEMBL3589085 | US9278953, 13)
Affinity DataKi:  31.6nM ΔG°:  -42.8kJ/molepH: 7.4 T: 2°CAssay Description:Test compounds were half log serially diluted in 100% DMSO (J. T. Baker #922401). 1 uL of each compound was added to appropriate wells of a 384-well ...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231881(CHEMBL4063807)
Affinity DataKi:  34nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50086599(CHEMBL3426297)
Affinity DataKi:  41nMAssay Description:Displacement of [125I]-17 from human GLP-1R expressed in CHO cell membranes incubated for 120 mins by scintillation counting based radioligand bindin...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Displayed 1 to 50 (of 311 total ) | Next | Last >>
Jump to: