Found 230 with Last Name = 'villoutreix' and Initial = 'b' 
Affinity DataKi: 4.40E+3nMAssay Description:Inhibition of human kallikrein 5 measured after 15 mins at pH 8 by double-reciprocal plot analysisMore data for this Ligand-Target Pair
Affinity DataKi: 5.20E+3nMAssay Description:Inhibition of biotinylated VEGF-A165 from rat recombinant NRP-1 Fc domainMore data for this Ligand-Target Pair
Affinity DataKi: 7.30E+3nMAssay Description:Inhibition of biotinylated VEGF-A165 from rat recombinant NRP-1 Fc domainMore data for this Ligand-Target Pair
Affinity DataKi: 9.40E+3nMAssay Description:Inhibition of biotinylated VEGF-A165 from rat recombinant NRP-1 Fc domainMore data for this Ligand-Target Pair
Affinity DataKi: 1.07E+4nMAssay Description:Inhibition of biotinylated VEGF-A165 from rat recombinant NRP-1 Fc domainMore data for this Ligand-Target Pair
Affinity DataKi: 1.13E+4nMAssay Description:Inhibition of biotinylated VEGF-A165 from rat recombinant NRP-1 Fc domainMore data for this Ligand-Target Pair
Affinity DataKi: 1.50E+4nMAssay Description:Mixed-type inhibition of human kallikrein7 using Suc-Leu-Leu-Val-Tyr-AMC as substrate assessed as enzyme-inhibitor complex after 15 to 60 mins by Lin...More data for this Ligand-Target Pair
Affinity DataKi: 4.40E+4nMAssay Description:Mixed-type inhibition of human kallikrein7 using Suc-Leu-Leu-Val-Tyr-AMC as substrate assessed as enzyme-substrate-inhibitor complex after 15 to 60 m...More data for this Ligand-Target Pair
Affinity DataKi: 5.00E+4nMAssay Description:Mixed-type inhibition of human kallikrein7 using Suc-Leu-Leu-Val-Tyr-AMC as substrate assessed as enzyme-inhibitor complex after 15 to 60 mins by Lin...More data for this Ligand-Target Pair
Affinity DataKi: 5.50E+4nMAssay Description:Mixed-type inhibition of human kallikrein7 using Suc-Leu-Leu-Val-Tyr-AMC as substrate assessed as enzyme-inhibitor complex after 15 to 60 mins by Lin...More data for this Ligand-Target Pair
Affinity DataKi: 7.00E+4nMAssay Description:Mixed-type inhibition of human kallikrein7 using Suc-Leu-Leu-Val-Tyr-AMC as substrate assessed as enzyme-inhibitor complex after 15 to 60 mins by Lin...More data for this Ligand-Target Pair
Affinity DataKi: 7.20E+4nMAssay Description:Mixed-type inhibition of human kallikrein7 using Suc-Leu-Leu-Val-Tyr-AMC as substrate assessed as enzyme-inhibitor complex after 15 to 60 mins by Lin...More data for this Ligand-Target Pair
Affinity DataKi: 7.50E+4nMAssay Description:Mixed-type inhibition of human kallikrein7 using Suc-Leu-Leu-Val-Tyr-AMC as substrate assessed as enzyme-inhibitor complex after 15 to 60 mins by Lin...More data for this Ligand-Target Pair
Affinity DataKi: 8.30E+4nMAssay Description:Mixed-type inhibition of human kallikrein7 using Suc-Leu-Leu-Val-Tyr-AMC as substrate assessed as enzyme-inhibitor complex after 15 to 60 mins by Lin...More data for this Ligand-Target Pair
Affinity DataKi: 9.50E+4nMAssay Description:Competitive inhibition of human kallikrein5 using Boc-Val-Pro-Arg-AMC as substrate after 15 to 60 mins by Lineweaver-Burk/Eadie-Hofstee plot analysisMore data for this Ligand-Target Pair
Affinity DataKi: 9.50E+4nMAssay Description:Mixed-type inhibition of human kallikrein7 using Suc-Leu-Leu-Val-Tyr-AMC as substrate assessed as enzyme-inhibitor complex after 15 to 60 mins by Lin...More data for this Ligand-Target Pair
Affinity DataKi: 1.00E+5nMAssay Description:Competitive inhibition of human kallikrein5 using Boc-Val-Pro-Arg-AMC as substrate after 15 to 60 mins by Lineweaver-Burk/Eadie-Hofstee plot analysisMore data for this Ligand-Target Pair
Affinity DataKi: 1.07E+5nMAssay Description:Competitive inhibition of human kallikrein5 using Boc-Val-Pro-Arg-AMC as substrate after 15 to 60 mins by Lineweaver-Burk/Eadie-Hofstee plot analysisMore data for this Ligand-Target Pair
Affinity DataKi: 1.12E+5nMAssay Description:Competitive inhibition of human kallikrein5 using Boc-Val-Pro-Arg-AMC as substrate after 15 to 60 mins by Lineweaver-Burk/Eadie-Hofstee plot analysisMore data for this Ligand-Target Pair
Affinity DataKi: 1.21E+5nMAssay Description:Competitive inhibition of human kallikrein5 using Boc-Val-Pro-Arg-AMC as substrate after 15 to 60 mins by Lineweaver-Burk/Eadie-Hofstee plot analysisMore data for this Ligand-Target Pair
Affinity DataKi: 1.29E+5nMAssay Description:Mixed-type inhibition of human kallikrein7 using Suc-Leu-Leu-Val-Tyr-AMC as substrate assessed as enzyme-substrate-inhibitor complex after 15 to 60 m...More data for this Ligand-Target Pair
Affinity DataKi: 1.31E+5nMAssay Description:Mixed-type inhibition of human kallikrein7 using Suc-Leu-Leu-Val-Tyr-AMC as substrate assessed as enzyme-substrate-inhibitor complex after 15 to 60 m...More data for this Ligand-Target Pair
Affinity DataKi: 1.40E+5nMAssay Description:Mixed-type inhibition of human kallikrein7 using Suc-Leu-Leu-Val-Tyr-AMC as substrate assessed as enzyme-substrate-inhibitor complex after 15 to 60 m...More data for this Ligand-Target Pair
Affinity DataKi: 1.52E+5nMAssay Description:Mixed-type inhibition of human kallikrein7 using Suc-Leu-Leu-Val-Tyr-AMC as substrate assessed as enzyme-substrate-inhibitor complex after 15 to 60 m...More data for this Ligand-Target Pair
Affinity DataKi: 1.64E+5nMAssay Description:Mixed-type inhibition of human kallikrein7 using Suc-Leu-Leu-Val-Tyr-AMC as substrate assessed as enzyme-substrate-inhibitor complex after 15 to 60 m...More data for this Ligand-Target Pair
Affinity DataKi: 1.66E+5nMAssay Description:Mixed-type inhibition of human kallikrein7 using Suc-Leu-Leu-Val-Tyr-AMC as substrate assessed as enzyme-substrate-inhibitor complex after 15 to 60 m...More data for this Ligand-Target Pair
Affinity DataKi: 1.66E+5nMAssay Description:Mixed-type inhibition of human kallikrein7 using Suc-Leu-Leu-Val-Tyr-AMC as substrate assessed as enzyme-substrate-inhibitor complex after 15 to 60 m...More data for this Ligand-Target Pair
Affinity DataIC50: 40nMAssay Description:Inhibition of human kallikrein 7 measured after 15 mins at pH 8 by fluorescence assayMore data for this Ligand-Target Pair
Affinity DataIC50: 140nMAssay Description:Inhibition of human kallikrein 5 measured after 15 mins at pH 8 by fluorescence assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille
Curated by ChEMBL
University Of Lille
Curated by ChEMBL
Affinity DataIC50: 170nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
Affinity DataIC50: 220nMAssay Description:Inhibition of human kallikrein 7 measured after 15 mins at pH 8 by fluorescence assayMore data for this Ligand-Target Pair
Affinity DataIC50: 230nMAssay Description:Inhibition of human kallikrein 7 measured after 15 mins at pH 8 by fluorescence assayMore data for this Ligand-Target Pair
Affinity DataIC50: 270nMAssay Description:Inhibition of human kallikrein 5 measured after 15 mins at pH 8 by fluorescence assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille
Curated by ChEMBL
University Of Lille
Curated by ChEMBL
Affinity DataIC50: 300nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille
Curated by ChEMBL
University Of Lille
Curated by ChEMBL
Affinity DataIC50: 340nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
Affinity DataIC50: 420nMAssay Description:Inhibition of human matriptase measured after 15 mins at pH 8 by fluorescence assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille
Curated by ChEMBL
University Of Lille
Curated by ChEMBL
Affinity DataIC50: 490nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille
Curated by ChEMBL
University Of Lille
Curated by ChEMBL
Affinity DataIC50: 540nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
Affinity DataIC50: 570nMAssay Description:Inhibition of human matriptase measured after 15 mins at pH 8 by fluorescence assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
University Of Lille
Curated by ChEMBL
University Of Lille
Curated by ChEMBL
Affinity DataIC50: 610nMAssay Description:Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst...More data for this Ligand-Target Pair
Affinity DataIC50: 610nMAssay Description:Inhibition of human kallikrein 7 measured after 15 mins at pH 8 by fluorescence assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
University Of Lille
Curated by ChEMBL
University Of Lille
Curated by ChEMBL
Affinity DataIC50: 630nMAssay Description:Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst...More data for this Ligand-Target Pair
Affinity DataIC50: 660nMAssay Description:Inhibition of human kallikrein 7 measured after 15 mins at pH 8 by fluorescence assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille
Curated by ChEMBL
University Of Lille
Curated by ChEMBL
Affinity DataIC50: 670nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille
Curated by ChEMBL
University Of Lille
Curated by ChEMBL
Affinity DataIC50: 700nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
University Of Lille
Curated by ChEMBL
University Of Lille
Curated by ChEMBL
Affinity DataIC50: 730nMAssay Description:Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
University Of Lille
Curated by ChEMBL
University Of Lille
Curated by ChEMBL
Affinity DataIC50: 790nMAssay Description:Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille
Curated by ChEMBL
University Of Lille
Curated by ChEMBL
Affinity DataIC50: 810nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille
Curated by ChEMBL
University Of Lille
Curated by ChEMBL
Affinity DataIC50: 880nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
Affinity DataIC50: 970nMAssay Description:Inhibition of human kallikrein 14 measured after 15 mins at pH 8 by fluorescence assayMore data for this Ligand-Target Pair
