Compile Data Set for Download or QSAR
maximum 50k data
Found 42 with Last Name = 'winters' and Initial = 'ka'
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50241203(CHEMBL414357 | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGS...)
Affinity DataIC50:  0.660nMAssay Description:Displacement of [125I]GLP1 from human GLP1R expressed in CHOK1 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261508(CHEMBL525934 | [Gly8,Glu22]GLP-1(7,37)-NH2)
Affinity DataIC50:  1.10nMAssay Description:Displacement of [125I]GLP1 from human GLP1R expressed in CHOK1 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261506(CHEMBL499930 | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-NH2)
Affinity DataIC50:  1.70nMAssay Description:Displacement of [125I]GLP1 from human GLP1R expressed in CHOK1 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261516(CHEMBL499133 | c[Glu23-Lys27][Gly8]GLP-1(7-37)-NH2)
Affinity DataIC50:  1.90nMAssay Description:Displacement of [125I]GLP1 from human GLP1R expressed in CHOK1 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261515(CHEMBL524907 | c[Glu22-Lys26][Gly8]GLP-1(7-37)-NH2)
Affinity DataIC50:  2.10nMAssay Description:Displacement of [125I]GLP1 from human GLP1R expressed in CHOK1 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261519(CHEMBL527077 | c[Glu22-Lys26][Gly8]GLP-1(7-37)-NH2)
Affinity DataIC50:  2.70nMAssay Description:Displacement of [125I]GLP1 from human GLP1R expressed in CHOK1 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261507(CHEMBL526685 | [Gly8]GLP-1(7-37)-NH2)
Affinity DataIC50:  2.80nMAssay Description:Displacement of [125I]GLP1 from human GLP1R expressed in CHOK1 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261509(CHEMBL499370 | [Gly8, aib22]GLP-1(7-37)-NH2)
Affinity DataIC50:  2.90nMAssay Description:Displacement of [125I]GLP1 from human GLP1R expressed in CHOK1 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261510(CHEMBL499208 | c[Glu18-Lys22][Gly8]GLP-1(7-37)-NH2)
Affinity DataIC50:  3.60nMAssay Description:Displacement of [125I]GLP1 from human GLP1R expressed in CHOK1 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261522(CHEMBL507645 | c[hGlu22-Lys26][Gly8]GLP-1(7-37)-NH...)
Affinity DataIC50:  6.20nMAssay Description:Displacement of [125I]GLP1 from human GLP1R expressed in CHOK1 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261520(CHEMBL526730 | c[Glu22-Orn26][Gly8]GLP-1(7-37)-NH2)
Affinity DataIC50:  6.40nMAssay Description:Displacement of [125I]GLP1 from human GLP1R expressed in CHOK1 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261518(CHEMBL500447 | c[Glu26-Lys30][Gly8]GLP-1(7-37)-NH2)
Affinity DataIC50:  16nMAssay Description:Displacement of [125I]GLP1 from human GLP1R expressed in CHOK1 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261511(CHEMBL507190 | c[Glu19-Lys23][Gly8]GLP-1(7-37)-NH2)
Affinity DataIC50:  17nMAssay Description:Displacement of [125I]GLP1 from human GLP1R expressed in CHOK1 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261512(CHEMBL524538 | Glu20-Lys24][Gly8][GLP-1(7-37)-NH2)
Affinity DataIC50:  26nMAssay Description:Displacement of [125I]GLP1 from human GLP1R expressed in CHOK1 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261513(CHEMBL525956 | c[Glu21-Lys25][Gly8]GLP-1(7-37)-NH2)
Affinity DataIC50:  60nMAssay Description:Displacement of [125I]GLP1 from human GLP1R expressed in CHOK1 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261521(CHEMBL526684 | c[Asp22-Lys26][Gly8]GLP-1(7-37)-NH2)
Affinity DataIC50:  64nMAssay Description:Displacement of [125I]GLP1 from human GLP1R expressed in CHOK1 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261524(CHEMBL526893 | c[Glu21-Lys26][Gly8]GLP-1(7-37)-NH2)
Affinity DataIC50:  210nMAssay Description:Displacement of [125I]GLP1 from human GLP1R expressed in CHOK1 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261514(CHEMBL505224 | c[Glu24-Lys28][Gly8]GLP-1(7-37)-NH2)
Affinity DataIC50:  290nMAssay Description:Displacement of [125I]GLP1 from human GLP1R expressed in CHOK1 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261523(CHEMBL504234 | c[beta-hGlu22-Lys26][Gly8]GLP-1(7-3...)
Affinity DataIC50: >500nMAssay Description:Displacement of [125I]GLP1 from human GLP1R expressed in CHOK1 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261517(CHEMBL504759 | c[Glu25-Lys29][Gly8]GLP-1(7-37)-NH2)
Affinity DataIC50: >1.00E+3nMAssay Description:Displacement of [125I]GLP1 from human GLP1R expressed in CHOK1 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261525(CHEMBL468769 | c[Cpa19-Lys26][Gly8]GLP-1(7-37)-NH2)
Affinity DataIC50:  2.00E+3nMAssay Description:Displacement of [125I]GLP1 from human GLP1R expressed in CHOK1 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50241203(CHEMBL414357 | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGS...)
Affinity DataEC50:  0.00400nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as increase in cAMP level by cAMP-response element/luciferase activation assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261512(CHEMBL524538 | Glu20-Lys24][Gly8][GLP-1(7-37)-NH2)
Affinity DataEC50:  0.450nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as increase in cAMP level by cAMP-response element/luciferase activation assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261513(CHEMBL525956 | c[Glu21-Lys25][Gly8]GLP-1(7-37)-NH2)
Affinity DataEC50:  0.140nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as increase in cAMP level by cAMP-response element/luciferase activation assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261514(CHEMBL505224 | c[Glu24-Lys28][Gly8]GLP-1(7-37)-NH2)
Affinity DataEC50:  0.740nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as increase in cAMP level by cAMP-response element/luciferase activation assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261515(CHEMBL524907 | c[Glu22-Lys26][Gly8]GLP-1(7-37)-NH2)
Affinity DataEC50:  0.0100nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as increase in cAMP level by cAMP-response element/luciferase activation assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261516(CHEMBL499133 | c[Glu23-Lys27][Gly8]GLP-1(7-37)-NH2)
Affinity DataEC50:  0.00800nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as increase in cAMP level by cAMP-response element/luciferase activation assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261517(CHEMBL504759 | c[Glu25-Lys29][Gly8]GLP-1(7-37)-NH2)
Affinity DataEC50:  15nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as increase in cAMP level by cAMP-response element/luciferase activation assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261508(CHEMBL525934 | [Gly8,Glu22]GLP-1(7,37)-NH2)
Affinity DataEC50:  0.00300nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as increase in cAMP level by cAMP-response element/luciferase activation assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261509(CHEMBL499370 | [Gly8, aib22]GLP-1(7-37)-NH2)
Affinity DataEC50:  0.0270nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as increase in cAMP level by cAMP-response element/luciferase activation assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261510(CHEMBL499208 | c[Glu18-Lys22][Gly8]GLP-1(7-37)-NH2)
Affinity DataEC50:  0.00600nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as increase in cAMP level by cAMP-response element/luciferase activation assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261511(CHEMBL507190 | c[Glu19-Lys23][Gly8]GLP-1(7-37)-NH2)
Affinity DataEC50:  0.0770nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as increase in cAMP level by cAMP-response element/luciferase activation assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261523(CHEMBL504234 | c[beta-hGlu22-Lys26][Gly8]GLP-1(7-3...)
Affinity DataEC50:  1.80nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as increase in cAMP level by cAMP-response element/luciferase activation assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261524(CHEMBL526893 | c[Glu21-Lys26][Gly8]GLP-1(7-37)-NH2)
Affinity DataEC50:  0.470nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as increase in cAMP level by cAMP-response element/luciferase activation assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261525(CHEMBL468769 | c[Cpa19-Lys26][Gly8]GLP-1(7-37)-NH2)
Affinity DataEC50:  9nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as increase in cAMP level by cAMP-response element/luciferase activation assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261506(CHEMBL499930 | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-NH2)
Affinity DataEC50:  0.00600nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as increase in cAMP level by cAMP-response element/luciferase activation assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261507(CHEMBL526685 | [Gly8]GLP-1(7-37)-NH2)
Affinity DataEC50:  0.0140nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as increase in cAMP level by cAMP-response element/luciferase activation assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261518(CHEMBL500447 | c[Glu26-Lys30][Gly8]GLP-1(7-37)-NH2)
Affinity DataEC50:  0.0240nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as increase in cAMP level by cAMP-response element/luciferase activation assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261519(CHEMBL527077 | c[Glu22-Lys26][Gly8]GLP-1(7-37)-NH2)
Affinity DataEC50:  0.00800nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as increase in cAMP level by cAMP-response element/luciferase activation assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261520(CHEMBL526730 | c[Glu22-Orn26][Gly8]GLP-1(7-37)-NH2)
Affinity DataEC50:  0.0190nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as increase in cAMP level by cAMP-response element/luciferase activation assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261521(CHEMBL526684 | c[Asp22-Lys26][Gly8]GLP-1(7-37)-NH2)
Affinity DataEC50:  0.140nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as increase in cAMP level by cAMP-response element/luciferase activation assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
Amgen

Curated by ChEMBL
LigandPNGBDBM50261522(CHEMBL507645 | c[hGlu22-Lys26][Gly8]GLP-1(7-37)-NH...)
Affinity DataEC50:  0.00400nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as increase in cAMP level by cAMP-response element/luciferase activation assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed