Found 5 of ic50 for monomerid = 50441574 TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille
Curated by ChEMBL
University Of Lille
Curated by ChEMBL
Affinity DataIC50: 170nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
University Of Lille
Curated by ChEMBL
University Of Lille
Curated by ChEMBL
Affinity DataIC50: 630nMAssay Description:Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst...More data for this Ligand-Target Pair
TargetDisintegrin and metalloproteinase domain-containing protein 17(Homo sapiens (Human))
University Of Lille
Curated by ChEMBL
University Of Lille
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human TACE after 5 minsMore data for this Ligand-Target Pair
Affinity DataIC50: >1.00E+5nMAssay Description:Inhibition of human MMP-7 after 45 minsMore data for this Ligand-Target Pair
Affinity DataIC50: >1.00E+5nMAssay Description:Inhibition of human MMP-12 after 60 minsMore data for this Ligand-Target Pair
