Compile Data Set for Download or QSAR
maximum 50k data
Found 3 of ic50 for monomerid = 50557749
TargetTGF-beta receptor type-2(Homo sapiens (Human))
Japan Tobacco

Curated by ChEMBL
LigandPNGBDBM50557749(CHEMBL4783244)
Affinity DataIC50:  75nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetActivin receptor type-2A(Homo sapiens (Human))
Japan Tobacco

Curated by ChEMBL
LigandPNGBDBM50557749(CHEMBL4783244)
Affinity DataIC50:  1.30E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTGF-beta receptor type-1(Homo sapiens (Human))
Japan Tobacco

Curated by ChEMBL
LigandPNGBDBM50557749(CHEMBL4783244)
Affinity DataIC50:  4.40E+3nMAssay Description:Inhibition of ALK5 (unknown origin) using biotin-labelled KKKVLTQMGSPSIRCSpSVS substrate in presence of [gamma33P] ATP measured after 40 minMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed