Compile Data Set for Download or QSAR
maximum 50k data
Report error Found 1 Enz. Inhib. hit(s) with Target = 'Tyrosine-protein kinase JAK2' and Ligand = 'BDBM239971'
TargetTyrosine-protein kinase JAK2(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239971(US9403801, 37)
Affinity DataIC50:  11nMpH: 7.0 T: 25°CAssay Description:JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent