Compile Data Set for Download or QSAR
maximum 50k data
Report error Found 2 of ic50 for UniProtKB: P50750
TargetCDK9/Cyclin-T2(Homo sapiens (Human))
The People'S Hospital of Xinjiang Uyghur Autonomous Region

Curated by ChEMBL
LigandPNGBDBM50193104(CHEMBL3905910)
Affinity DataIC50:  0.626nMAssay Description:Inhibition of CDK9/Cyclin T2 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetCDK9/Cyclin-T2(Homo sapiens (Human))
The People'S Hospital of Xinjiang Uyghur Autonomous Region

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  3.80nMAssay Description:Inhibition of human CDK9/cyclin-T2 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed