Found 106 of ic50 for monomerid = 103727 
Affinity DataIC50: 10nMAssay Description:Inhibition of JAK1 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 10nMAssay Description:Inhibition of human recombinant JAK1More data for this Ligand-Target Pair
Affinity DataIC50: 10nMAssay Description:Inhibition of JAK 1 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 10nMAssay Description:Inhibition of recombinant JAK1 (unknown origin) in the presence of ATPMore data for this Ligand-Target Pair
Affinity DataIC50: 25nMAssay Description:Inhibition of JAK2 (unknown origin)More data for this Ligand-Target Pair
3D Structure (crystal)Affinity DataIC50: 26nMAssay Description:Inhibition of recombinant JAK1 (unknown origin) using GFP-STAT1 as substrate incubated for 1 hr followed by anti-pSTAT1 antibody addition and measure...More data for this Ligand-Target Pair
Affinity DataIC50: 28nMAssay Description:Inhibition of recombinant JAK2 (unknown origin) in the presence of ATPMore data for this Ligand-Target Pair
Affinity DataIC50: 28nMAssay Description:Inhibition of JAK 2 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 29nMAssay Description:Inhibition of rat JAK1More data for this Ligand-Target Pair
Affinity DataIC50: 31.4nMAssay Description:In vitro inhibition assay using various enzyme.More data for this Ligand-Target Pair
Affinity DataIC50: 31.4nMAssay Description:Recombinant human JAK2 catalytic domain (amino acids 808-1132; catalog number PV4210) was purchased from Invitrogen. 0.025 mU of JAK2 was incubated w...More data for this Ligand-Target Pair
Affinity DataIC50: 33nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Affinity DataIC50: 41.2nMAssay Description:In vitro inhibition assay using various enzyme.More data for this Ligand-Target Pair
Affinity DataIC50: 46nMAssay Description:The study of the effect of compounds on the activity of purified recombinant JAK was performed by studying the inhibitory activity of the compounds o...More data for this Ligand-Target Pair
Affinity DataIC50: 47.1nMAssay Description:In vitro inhibition assay using various enzyme.More data for this Ligand-Target Pair
Affinity DataIC50: 47.1nMAssay Description:Recombinant human JAK1 catalytic domain (amino acids 850-1154; catalog number 08-144) was purchased from Carna Biosciences. 10 ng of JAK1 was incubat...More data for this Ligand-Target Pair
Affinity DataIC50: 48.3nMAssay Description:In vitro inhibition assay using various enzyme.More data for this Ligand-Target Pair
Affinity DataIC50: 50nMAssay Description:The assays were performed in 384-well, low volume microtiter assay plates in a final reaction volume of 9 ul. Dose-response curves were generated by ...More data for this Ligand-Target Pair
Affinity DataIC50: 50nMpH: 7.5Assay Description:A kinase selectivity panel which measures substrate peptide phosphorylation was set-up for recombinant human Jak1 (aa 866-1154), Jak2 (aa808-1132), J...More data for this Ligand-Target Pair
Affinity DataIC50: 50nMAssay Description:JAK1 (IC50): Recombinant human JAK1 catalytic domain (amino acids 850-1154; catalog number 08-144) is purchased from Carna Biosciences. 10 ng of JAK1...More data for this Ligand-Target Pair
Affinity DataIC50: 50nMAssay Description:The assays were performed in 384-well, low volume microtiter assay plates in a final reaction volume of 9 ul. Dose-response curves were generated by ...More data for this Ligand-Target Pair
Affinity DataIC50: 50.1nMAssay Description:In vitro inhibition assay using various enzyme.More data for this Ligand-Target Pair
Affinity DataIC50: 50.3nMAssay Description:Recombinant human JAK1 catalytic domain (amino acids 850-1154; catalog number 08-144) is purchased from Carna Biosciences. 10 ng of JAK1 is incubated...More data for this Ligand-Target Pair
Affinity DataIC50: 55nMAssay Description:The study of the effect of compounds on the activity of purified recombinant JAK was performed by studying the inhibitory activity of the compounds o...More data for this Ligand-Target Pair
Affinity DataIC50: 55.5nMAssay Description:In vitro inhibition assay using various enzyme.More data for this Ligand-Target Pair
Affinity DataIC50: 55.7nMAssay Description:In vitro inhibition assay using various enzyme.More data for this Ligand-Target Pair
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
Ewha Womans University
Curated by ChEMBL
Ewha Womans University
Curated by ChEMBL
Affinity DataIC50: 65nMAssay Description:Inhibition of recombinant TYK2 (unknown origin) using GFP-STAT1 as substrate incubated for 1 hr followed by anti-pSTAT1 antibody addition and measure...More data for this Ligand-Target Pair
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
Ewha Womans University
Curated by ChEMBL
Ewha Womans University
Curated by ChEMBL
Affinity DataIC50: 72.7nMAssay Description:In vitro inhibition assay using various enzyme.More data for this Ligand-Target Pair
Affinity DataIC50: 72.7nMAssay Description:Recombinant human TYK2 catalytic domain (amino acids 871-1187; catalog number 08-147) was purchased from Carna biosciences. 5 ng of TYK2 was incubate...More data for this Ligand-Target Pair
Affinity DataIC50: 73.4nMAssay Description:Recombinant human JAK2 catalytic domain (amino acids 808-1132; catalog number PV4210) is purchased from Invitrogen. 0.025 mU of JAK2 is incubated wit...More data for this Ligand-Target Pair
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
Ewha Womans University
Curated by ChEMBL
Ewha Womans University
Curated by ChEMBL
Affinity DataIC50: 73.8nMAssay Description:In vitro inhibition assay using various enzyme.More data for this Ligand-Target Pair
Affinity DataIC50: 74nMAssay Description:JAK1 (KI): For the determination of Ki, different amounts of compound are mixed with the enzyme and the enzymatic reaction is followed as a function ...More data for this Ligand-Target Pair
Affinity DataIC50: 74nMAssay Description:Inhibition of JAK2 (unknown origin) in presence of ATP at Km concentration by caliper assayMore data for this Ligand-Target Pair
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
Ewha Womans University
Curated by ChEMBL
Ewha Womans University
Curated by ChEMBL
Affinity DataIC50: 78nMAssay Description:Recombinant human TYK2 catalytic domain (amino acids 871-1187; catalog number 08-147) is purchased from Carna biosciences. 5 ng of TYK2 is incubated ...More data for this Ligand-Target Pair
Affinity DataIC50: 78nMAssay Description:JAK2 (Kd): JAK2 (Invitrogen, PV4210) is used at a final concentration of 5 nM. The binding experiment is performed in 50 mM Hepes pH 7.5, 0.01% Brij-...More data for this Ligand-Target Pair
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
Ewha Womans University
Curated by ChEMBL
Ewha Womans University
Curated by ChEMBL
Affinity DataIC50: 79.1nMAssay Description:In vitro inhibition assay using various enzyme.More data for this Ligand-Target Pair
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
Ewha Womans University
Curated by ChEMBL
Ewha Womans University
Curated by ChEMBL
Affinity DataIC50: 86.8nMAssay Description:In vitro inhibition assay using various enzyme.More data for this Ligand-Target Pair
Affinity DataIC50: <100nMAssay Description:Recombinant human JAK1 catalytic domain (amino acids 850-1154; catalog number 08-144) was purchased from Carna Biosciences. 10 ng of JAK1 was incubat...More data for this Ligand-Target Pair
Affinity DataIC50: <100nMAssay Description:Recombinant human JAK2 catalytic domain (amino acids 808-1132; catalog number PV4210) was purchased from Invitrogen. 0.025 mU of JAK2 was incubated w...More data for this Ligand-Target Pair
Affinity DataIC50: <100nMAssay Description:Recombinant human JAK3 catalytic domain (amino acids 781-1124; catalog number PV3855) was purchased from Invitrogen. 0.025 mU of JAK3 was incubated w...More data for this Ligand-Target Pair
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
Ewha Womans University
Curated by ChEMBL
Ewha Womans University
Curated by ChEMBL
Affinity DataIC50: 113nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
Affinity DataIC50: 115nMAssay Description:Inhibition of JAK1 (unknown origin) in presence of ATP at Km concentration by caliper assayMore data for this Ligand-Target Pair
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
Ewha Womans University
Curated by ChEMBL
Ewha Womans University
Curated by ChEMBL
Affinity DataIC50: 116nMAssay Description:Inhibition of Tyk2 (unknown origin)More data for this Ligand-Target Pair
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
Ewha Womans University
Curated by ChEMBL
Ewha Womans University
Curated by ChEMBL
Affinity DataIC50: 116nMAssay Description:Inhibition of recombinant TYK2 (unknown origin) in the presence of ATPMore data for this Ligand-Target Pair
Affinity DataIC50: 122nMAssay Description:Inhibition of recombinant human JAK2 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presence of Mg/ATP mixture b...More data for this Ligand-Target Pair
Affinity DataIC50: 149nMAssay Description:Recombinant human JAK3 catalytic domain (amino acids 781-1124; catalog number PV3855) was purchased from Invitrogen. 0.025 mU of JAK3 was incubated w...More data for this Ligand-Target Pair
Affinity DataIC50: 149nMAssay Description:In vitro inhibition assay using various enzyme.More data for this Ligand-Target Pair
Affinity DataIC50: 167nMAssay Description:In vitro inhibition assay using various enzyme.More data for this Ligand-Target Pair
Affinity DataIC50: 171nMAssay Description:Inhibition of recombinant JAK2 (unknown origin) using GFP-STAT1 as substrate incubated for 1 hr followed by anti-pSTAT1 antibody addition and measure...More data for this Ligand-Target Pair
Affinity DataIC50: 180nMAssay Description:JAK2 (IC50): Recombinant human JAK2 catalytic domain (amino acids 808-1132; catalog number PV4210) is purchased from Invitrogen. 0.025 mU of JAK2 is ...More data for this Ligand-Target Pair
