Compile Data Set for Download or QSAR
Report error Found 36 Enz. Inhib. hit(s) with all data for entry = 50039045
TargetGalanin receptor type 1(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273370BDBM50273370(CHEMBL503473 | M35 | Galanin (1-13)-bradikinin(2-9...)
Affinity DataKi:  0.0100nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 1(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273369BDBM50273369(CHEMBL526003 | Galanin (1-13)-SP-(5-11) | galantid...)
Affinity DataKi:  0.0300nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 1(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50378616BDBM50378616(GALANIN)
Affinity DataKi:  0.0300nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 1(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307256BDBM50307256(Gal(1-13)-Std I | CHEMBL604373 | GWTLNSAGYLLGPrPKP...)
Affinity DataKi:  0.0800nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 1(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307254BDBM50307254(M40 | CHEMBL604990 | GWTLNSAGYLLGPPPALALA-CONH2)
Affinity DataKi:  0.100nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 1(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307255BDBM50307255(GWTLNSAGYLLGPRHYINLITRQRY-CONH2 | CHEMBL592413)
Affinity DataKi:  0.300nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307256BDBM50307256(Gal(1-13)-Std I | CHEMBL604373 | GWTLNSAGYLLGPrPKP...)
Affinity DataKi:  0.600nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50378616BDBM50378616(GALANIN)
Affinity DataKi:  0.900nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273369BDBM50273369(CHEMBL526003 | Galanin (1-13)-SP-(5-11) | galantid...)
Affinity DataKi:  1.10nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307255BDBM50307255(GWTLNSAGYLLGPRHYINLITRQRY-CONH2 | CHEMBL592413)
Affinity DataKi:  1.40nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307254BDBM50307254(M40 | CHEMBL604990 | GWTLNSAGYLLGPPPALALA-CONH2)
Affinity DataKi:  1.5nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307252BDBM50307252(WTLNSAGYLL-CONH2 | CHEMBL578710)
Affinity DataKi:  1.70nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 1(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307258BDBM50307258([N-Ac,des-Sar]Gal-B2 | CHEMBL578317)
Affinity DataKi:  1.70nMAssay Description:Displacement of Eu-labeled galanin from human GalR1 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273370BDBM50273370(CHEMBL503473 | M35 | Galanin (1-13)-bradikinin(2-9...)
Affinity DataKi:  1.80nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 1(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273360BDBM50273360([Sar1Gly]GAL-B2 | (S)-N-((S)-6-amino-1-((S)-6-amin...)
Affinity DataKi:  2.80nMAssay Description:Displacement of Eu-labeled galanin from human GalR1 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 1(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307250BDBM50307250(GalB2 | CHEMBL578514)
Affinity DataKi:  3.5nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 1(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307250BDBM50307250(GalB2 | CHEMBL578514)
Affinity DataKi:  3.5nMAssay Description:Displacement of Eu-labeled galanin from human GalR1 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307253BDBM50307253(WTLNSAGYLLGPHAVGNHPSFSDKNGLTS-CONH2 | CHEMBL592415)
Affinity DataKi:  9.80nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 1(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307257BDBM50307257([Sar1Ala]GAL-B2 | CHEMBL578910)
Affinity DataKi:  11nMAssay Description:Displacement of Eu-labeled galanin from human GalR1 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307258BDBM50307258([N-Ac,des-Sar]Gal-B2 | CHEMBL578317)
Affinity DataKi:  16nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273360BDBM50273360([Sar1Gly]GAL-B2 | (S)-N-((S)-6-amino-1-((S)-6-amin...)
Affinity DataKi:  18nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307259BDBM50307259([N-Me,des-Sar]Gal-B2 | CHEMBL604991)
Affinity DataKi:  20nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307257BDBM50307257([Sar1Ala]GAL-B2 | CHEMBL578910)
Affinity DataKi:  35nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273358BDBM50273358(Gal-B5 | (S)-N-((S)-6-amino-1-((S)-6-amino-1-((S)-...)
Affinity DataKi:  48nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 1(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307253BDBM50307253(WTLNSAGYLLGPHAVGNHPSFSDKNGLTS-CONH2 | CHEMBL592415)
Affinity DataKi:  51nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307250BDBM50307250(GalB2 | CHEMBL578514)
Affinity DataKi:  52nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307250BDBM50307250(GalB2 | CHEMBL578514)
Affinity DataKi:  52nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307251BDBM50307251(GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS-CONH2 | CHEMBL59217...)
Affinity DataKi:  218nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 1(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307259BDBM50307259([N-Me,des-Sar]Gal-B2 | CHEMBL604991)
Affinity DataKi:  365nMAssay Description:Displacement of Eu-labeled galanin from human GalR1 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 1(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50273358BDBM50273358(Gal-B5 | (S)-N-((S)-6-amino-1-((S)-6-amino-1-((S)-...)
Affinity DataKi:  387nMAssay Description:Displacement of Eu-labeled galanin from human GalR1 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 1(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307251BDBM50307251(GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS-CONH2 | CHEMBL59217...)
Affinity DataKi:  545nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 1(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50307252BDBM50307252(WTLNSAGYLL-CONH2 | CHEMBL578710)
Affinity DataKi:  870nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 1(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50423646BDBM50423646(Galnon | CHEMBL2309599)
Affinity DataKi:  1.17E+4nMAssay Description:Displacement of Eu-labeled galanin from human GalR1 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Rat)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50423646BDBM50423646(Galnon | CHEMBL2309599)
Affinity DataKi:  3.41E+4nMAssay Description:Binding affinity to rat GalR2More data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 1(Human)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50415433BDBM50415433(CHEMBL1187471)
Affinity DataKi:  3.42E+4nMAssay Description:Displacement of Eu-labeled galanin from human GalR1 by DELFIA competitive assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed
TargetGalanin receptor type 2(Rat)
University of Utah

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50415433BDBM50415433(CHEMBL1187471)
Affinity DataKi: >1.00E+5nMAssay Description:Binding affinity to rat GalR2More data for this Ligand-Target Pair
In Depth
Date in BDB:
12/28/2012
Entry Details Article
PubMed