Compile Data Set for Download or QSAR
maximum 50k data
Found 36 Enz. Inhib. hit(s) with all data for entry = 50039045
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273370(CHEMBL503473 | GWTLNSAGYLLGPPPGFSPFR-CONH2 | Galan...)
Affinity DataKi:  0.0100nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50378616(GALANIN)
Affinity DataKi:  0.0300nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273369(CHEMBL526003 | GWTLNSAGYLLGPQQFFGLM-CONH2 | Galani...)
Affinity DataKi:  0.0300nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307256(CHEMBL604373 | GWTLNSAGYLLGPrPKPQQwFwLL-CONH2 | Ga...)
Affinity DataKi:  0.0800nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307254(CHEMBL604990 | GWTLNSAGYLLGPPPALALA-CONH2 | M40)
Affinity DataKi:  0.100nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307255(CHEMBL592413 | GWTLNSAGYLLGPRHYINLITRQRY-CONH2)
Affinity DataKi:  0.300nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307256(CHEMBL604373 | GWTLNSAGYLLGPrPKPQQwFwLL-CONH2 | Ga...)
Affinity DataKi:  0.600nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50378616(GALANIN)
Affinity DataKi:  0.900nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273369(CHEMBL526003 | GWTLNSAGYLLGPQQFFGLM-CONH2 | Galani...)
Affinity DataKi:  1.10nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307255(CHEMBL592413 | GWTLNSAGYLLGPRHYINLITRQRY-CONH2)
Affinity DataKi:  1.40nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307254(CHEMBL604990 | GWTLNSAGYLLGPPPALALA-CONH2 | M40)
Affinity DataKi:  1.5nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307258(CHEMBL578317 | [N-Ac,des-Sar]Gal-B2)
Affinity DataKi:  1.70nMAssay Description:Displacement of Eu-labeled galanin from human GalR1 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307252(CHEMBL578710 | WTLNSAGYLL-CONH2)
Affinity DataKi:  1.70nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273370(CHEMBL503473 | GWTLNSAGYLLGPPPGFSPFR-CONH2 | Galan...)
Affinity DataKi:  1.80nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273360((S)-N-((S)-6-amino-1-((S)-6-amino-1-((S)-1-((S)-1,...)
Affinity DataKi:  2.80nMAssay Description:Displacement of Eu-labeled galanin from human GalR1 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307250(CHEMBL578514 | GalB2)
Affinity DataKi:  3.5nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307250(CHEMBL578514 | GalB2)
Affinity DataKi:  3.5nMAssay Description:Displacement of Eu-labeled galanin from human GalR1 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307253(CHEMBL592415 | WTLNSAGYLLGPHAVGNHPSFSDKNGLTS-CONH2)
Affinity DataKi:  9.80nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307257(CHEMBL578910 | [Sar1Ala]GAL-B2)
Affinity DataKi:  11nMAssay Description:Displacement of Eu-labeled galanin from human GalR1 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307258(CHEMBL578317 | [N-Ac,des-Sar]Gal-B2)
Affinity DataKi:  16nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273360((S)-N-((S)-6-amino-1-((S)-6-amino-1-((S)-1-((S)-1,...)
Affinity DataKi:  18nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307259(CHEMBL604991 | [N-Me,des-Sar]Gal-B2)
Affinity DataKi:  20nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307257(CHEMBL578910 | [Sar1Ala]GAL-B2)
Affinity DataKi:  35nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273358((S)-N-((S)-6-amino-1-((S)-6-amino-1-((S)-1-((S)-1,...)
Affinity DataKi:  48nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307253(CHEMBL592415 | WTLNSAGYLLGPHAVGNHPSFSDKNGLTS-CONH2)
Affinity DataKi:  51nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307250(CHEMBL578514 | GalB2)
Affinity DataKi:  52nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307250(CHEMBL578514 | GalB2)
Affinity DataKi:  52nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307251(CHEMBL592170 | GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS-CONH...)
Affinity DataKi:  218nMAssay Description:Displacement of Eu-labeled galanin from human GalR2 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307259(CHEMBL604991 | [N-Me,des-Sar]Gal-B2)
Affinity DataKi:  365nMAssay Description:Displacement of Eu-labeled galanin from human GalR1 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50273358((S)-N-((S)-6-amino-1-((S)-6-amino-1-((S)-1-((S)-1,...)
Affinity DataKi:  387nMAssay Description:Displacement of Eu-labeled galanin from human GalR1 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307251(CHEMBL592170 | GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS-CONH...)
Affinity DataKi:  545nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50307252(CHEMBL578710 | WTLNSAGYLL-CONH2)
Affinity DataKi:  870nMAssay Description:Binding affinity to human GalR1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50423646(CHEMBL2309599 | Galnon)
Affinity DataKi:  1.17E+4nMAssay Description:Displacement of Eu-labeled galanin from human GalR1 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(RAT)
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50423646(CHEMBL2309599 | Galnon)
Affinity DataKi:  3.41E+4nMAssay Description:Binding affinity to rat GalR2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 1(Homo sapiens (Human))
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50415433(CHEMBL1187471)
Affinity DataKi:  3.42E+4nMAssay Description:Displacement of Eu-labeled galanin from human GalR1 by DELFIA competitive assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGalanin receptor type 2(RAT)
University Of Utah

Curated by ChEMBL
LigandPNGBDBM50415433(CHEMBL1187471)
Affinity DataKi: >1.00E+5nMAssay Description:Binding affinity to rat GalR2More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed