Compile Data Set for Download or QSAR
maximum 50k data
Report error Found 36 Enz. Inhib. hit(s) with all data for entry = 50045050
TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043385(CHEMBL3355072)
Affinity DataIC50:  0.300nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043387(CHEMBL3355074)
Affinity DataIC50:  0.400nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043382(CHEMBL3355069)
Affinity DataIC50:  0.5nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043384(CHEMBL3355071)
Affinity DataIC50:  0.5nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043383(CHEMBL3355070)
Affinity DataIC50:  1nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043386(CHEMBL3355073)
Affinity DataIC50:  1nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043389(CHEMBL3352844)
Affinity DataIC50:  2nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043381(CHEMBL3355068)
Affinity DataIC50:  9nMAssay Description:Inhibition of PI3Kalpha (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043381(CHEMBL3355068)
Affinity DataIC50:  26nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043388(CHEMBL3355075)
Affinity DataIC50:  29nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043387(CHEMBL3355074)
Affinity DataIC50:  37nMAssay Description:Inhibition of CHK1 in HeLa S3 cells assessed as inhibition of phosphorylation at ser345 by AlphaScreen SureFire CHK1 (p-Ser345) assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043382(CHEMBL3355069)
Affinity DataIC50:  40nMAssay Description:Inhibition of PI3Kalpha (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043401(CHEMBL3355079)
Affinity DataIC50:  41nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043382(CHEMBL3355069)
Affinity DataIC50:  44nMAssay Description:Inhibition of CHK1 in HeLa S3 cells assessed as inhibition of phosphorylation at ser345 by AlphaScreen SureFire CHK1 (p-Ser345) assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043402(CHEMBL3355080)
Affinity DataIC50:  64nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043385(CHEMBL3355072)
Affinity DataIC50:  80nMAssay Description:Inhibition of CHK1 in HeLa S3 cells assessed as inhibition of phosphorylation at ser345 by AlphaScreen SureFire CHK1 (p-Ser345) assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043384(CHEMBL3355071)
Affinity DataIC50:  123nMAssay Description:Inhibition of CHK1 in HeLa S3 cells assessed as inhibition of phosphorylation at ser345 by AlphaScreen SureFire CHK1 (p-Ser345) assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetSerine-protein kinase ATM(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043385(CHEMBL3355072)
Affinity DataIC50:  130nMAssay Description:Inhibition of ATM (unknown origin) using p53-Q10-K17 peptide substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetDNA-dependent protein kinase catalytic subunit(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043385(CHEMBL3355072)
Affinity DataIC50:  140nMAssay Description:Inhibition of DNA-PK (unknown origin) using GGGGMEEPQSDPSVEPPLSQETFSDLWKLLPE peptide substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043386(CHEMBL3355073)
Affinity DataIC50:  160nMAssay Description:Inhibition of CHK1 in HeLa S3 cells assessed as inhibition of phosphorylation at ser345 by AlphaScreen SureFire CHK1 (p-Ser345) assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetSerine/threonine-protein kinase Chk1(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043383(CHEMBL3355070)
Affinity DataIC50:  327nMAssay Description:Inhibition of CHK1 in HeLa S3 cells assessed as inhibition of phosphorylation at ser345 by AlphaScreen SureFire CHK1 (p-Ser345) assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043390(CHEMBL3355076)
Affinity DataIC50:  440nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetSerine/threonine-protein kinase mTOR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043385(CHEMBL3355072)
Affinity DataIC50:  1.10E+3nMAssay Description:Inhibition of mTOR (unknown origin) by alphascreen SureFire p70 S6K (p-Thr389) assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043383(CHEMBL3355070)
Affinity DataIC50:  1.10E+3nMAssay Description:Inhibition of PI3Kalpha (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetPotassium voltage-gated channel subfamily H member 2(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043385(CHEMBL3355072)
Affinity DataIC50:  1.50E+3nMAssay Description:Inhibition of human ERG by automated whole cell electrophysiologyMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetDNA-dependent protein kinase catalytic subunit(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043387(CHEMBL3355074)
Affinity DataIC50:  1.60E+3nMAssay Description:Inhibition of DNA-PK (unknown origin) using GGGGMEEPQSDPSVEPPLSQETFSDLWKLLPE peptide substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043392(CHEMBL3355078)
Affinity DataIC50:  2.10E+3nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetSerine/threonine-protein kinase mTOR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043386(CHEMBL3355073)
Affinity DataIC50: >2.30E+3nMAssay Description:Inhibition of mTOR (unknown origin) by alphascreen SureFire p70 S6K (p-Thr389) assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetSerine-protein kinase ATM(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043387(CHEMBL3355074)
Affinity DataIC50:  4.30E+3nMAssay Description:Inhibition of ATM (unknown origin) using p53-Q10-K17 peptide substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetSerine/threonine-protein kinase mTOR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043387(CHEMBL3355074)
Affinity DataIC50:  4.40E+3nMAssay Description:Inhibition of mTOR (unknown origin) by alphascreen SureFire p70 S6K (p-Thr389) assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetSerine/threonine-protein kinase ATR(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043391(CHEMBL3355077)
Affinity DataIC50:  6.20E+3nMAssay Description:Inhibition of ATR (unknown origin) using Avi-tagged protein substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetDNA-dependent protein kinase catalytic subunit(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043386(CHEMBL3355073)
Affinity DataIC50:  6.50E+3nMAssay Description:Inhibition of DNA-PK (unknown origin) using GGGGMEEPQSDPSVEPPLSQETFSDLWKLLPE peptide substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043384(CHEMBL3355071)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of PI3Kalpha (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMedPDB3D3D Structure (crystal)

TargetPotassium voltage-gated channel subfamily H member 2(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043387(CHEMBL3355074)
Affinity DataIC50:  1.25E+4nMAssay Description:Inhibition of human ERG by automated whole cell electrophysiologyMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetSerine-protein kinase ATM(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043386(CHEMBL3355073)
Affinity DataIC50:  1.40E+4nMAssay Description:Inhibition of ATM (unknown origin) using p53-Q10-K17 peptide substrate by alphascreen assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetPotassium voltage-gated channel subfamily H member 2(Human)
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50043386(CHEMBL3355073)
Affinity DataIC50: >3.00E+4nMAssay Description:Inhibition of human ERG by automated whole cell electrophysiologyMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed