Compile Data Set for Download or QSAR
maximum 50k data
Found 160 Enz. Inhib. hit(s) with all data for entry = 50012669
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559293(CHEMBL4789273)
Affinity DataIC50:  0.900nMAssay Description:Inhibition of recombinant human JAK2 (808 to end residues) [protein fragment, 39 aa] as substrate measured after 40 mins in presence of...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559279(CHEMBL4754856)
Affinity DataIC50:  2nMAssay Description:Inhibition of recombinant human JAK2 (808 to end residues) [protein fragment, 39 aa] as substrate measured after 40 mins in presence of...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559295(CHEMBL4741075)
Affinity DataIC50:  2nMAssay Description:Inhibition of recombinant human JAK2 (808 to end residues) [protein fragment, 39 aa] as substrate measured after 40 mins in presence of...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559282(CHEMBL4759953)
Affinity DataIC50:  3nMAssay Description:Inhibition of recombinant human JAK2 (808 to end residues) [protein fragment, 39 aa] as substrate measured after 40 mins in presence of...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559284(CHEMBL4753549)
Affinity DataIC50:  3nMAssay Description:Inhibition of recombinant human JAK2 (808 to end residues) [protein fragment, 39 aa] as substrate measured after 40 mins in presence of...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559275(CHEMBL4798378)
Affinity DataIC50:  7nMAssay Description:Inhibition of recombinant human JAK2 (808 to end residues) [protein fragment, 39 aa] as substrate measured after 40 mins in presence of...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559292(CHEMBL4756422)
Affinity DataIC50:  9nMAssay Description:Inhibition of recombinant human JAK2 (808 to end residues) [protein fragment, 39 aa] as substrate measured after 40 mins in presence of...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559281(CHEMBL4748354)
Affinity DataIC50:  10nMAssay Description:Inhibition of recombinant human JAK2 (808 to end residues) [protein fragment, 39 aa] as substrate measured after 40 mins in presence of...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Mus musculus)
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559279(CHEMBL4754856)
Affinity DataIC50:  10nMAssay Description:Inhibition of JAK2 V617F mutant in mouse BaF3 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Mus musculus)
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559281(CHEMBL4748354)
Affinity DataIC50:  10nMAssay Description:Inhibition of JAK2 V617F mutant in mouse BaF3 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559284(CHEMBL4753549)
Affinity DataIC50:  12nMAssay Description:Inhibition of JAK2 V617F mutant in human SET-2 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Mus musculus)
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559282(CHEMBL4759953)
Affinity DataIC50:  13nMAssay Description:Inhibition of JAK2 V617F mutant in mouse BaF3 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559279(CHEMBL4754856)
Affinity DataIC50:  14nMAssay Description:Inhibition of JAK2 V617F mutant in human SET-2 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559292(CHEMBL4756422)
Affinity DataIC50:  15nMAssay Description:Inhibition of JAK2 V617F mutant in human SET-2 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559282(CHEMBL4759953)
Affinity DataIC50:  15nMAssay Description:Inhibition of JAK2 V617F mutant in human SET-2 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559295(CHEMBL4741075)
Affinity DataIC50:  16nMAssay Description:Inhibition of recombinant human FLT3 D835Y mutant (564 to end residues) using EAIYAAPFAKKK as substrate at 40 mins in presence of [gamma-33ATP] by sc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559293(CHEMBL4789273)
Affinity DataIC50:  18nMAssay Description:Inhibition of recombinant human FLT3 D835Y mutant (564 to end residues) using EAIYAAPFAKKK as substrate at 40 mins in presence of [gamma-33ATP] by sc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559292(CHEMBL4756422)
Affinity DataIC50:  23nMAssay Description:Inhibition of recombinant human FLT3 D835Y mutant (564 to end residues) using EAIYAAPFAKKK as substrate at 40 mins in presence of [gamma-33ATP] by sc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559279(CHEMBL4754856)
Affinity DataIC50:  23nMAssay Description:Inhibition of recombinant human FLT3 D835Y mutant (564 to end residues) using EAIYAAPFAKKK as substrate at 40 mins in presence of [gamma-33ATP] by sc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559293(CHEMBL4789273)
Affinity DataIC50:  24nMAssay Description:Inhibition of human JAK1 (866 to end residues) using GEEPLYWSFPAKKK as substrate after 40 mins by [gamma-33ATP] radiometric assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559293(CHEMBL4789273)
Affinity DataIC50:  25nMAssay Description:Inhibition of JAK2 V617F mutant in human SET-2 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Mus musculus)
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559292(CHEMBL4756422)
Affinity DataIC50:  25nMAssay Description:Inhibition of JAK2 V617F mutant in mouse BaF3 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559279(CHEMBL4754856)
Affinity DataIC50:  26nMAssay Description:Inhibition of human JAK1 (866 to end residues) using GEEPLYWSFPAKKK as substrate after 40 mins by [gamma-33ATP] radiometric assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK3(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559293(CHEMBL4789273)
Affinity DataIC50:  28nMAssay Description:Inhibition of recombinant human JAK3 (781 to end residues) using GGEEEEYFELVKKKK as substrate measured after 40 mins in presence of [gamm33P]ATP by s...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559293(CHEMBL4789273)
Affinity DataIC50:  30nMAssay Description:Inhibition of recombinant human TYK2 (875 to end residues) using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of [gamma33P]ATP by ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559282(CHEMBL4759953)
Affinity DataIC50:  30nMAssay Description:Inhibition of recombinant human FLT3 D835Y mutant (564 to end residues) using EAIYAAPFAKKK as substrate at 40 mins in presence of [gamma-33ATP] by sc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559295(CHEMBL4741075)
Affinity DataIC50:  30nMAssay Description:Inhibition of human JAK1 (866 to end residues) using GEEPLYWSFPAKKK as substrate after 40 mins by [gamma-33ATP] radiometric assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559281(CHEMBL4748354)
Affinity DataIC50:  34nMAssay Description:Inhibition of recombinant human FLT3 D835Y mutant (564 to end residues) using EAIYAAPFAKKK as substrate at 40 mins in presence of [gamma-33ATP] by sc...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Mus musculus)
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559284(CHEMBL4753549)
Affinity DataIC50:  41nMAssay Description:Inhibition of JAK2 V617F mutant in mouse BaF3 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559284(CHEMBL4753549)
Affinity DataIC50:  42nMAssay Description:Inhibition of human JAK1 (866 to end residues) using GEEPLYWSFPAKKK as substrate after 40 mins by [gamma-33ATP] radiometric assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559275(CHEMBL4798378)
Affinity DataIC50:  43nMAssay Description:Inhibition of human JAK1 (866 to end residues) using GEEPLYWSFPAKKK as substrate after 40 mins by [gamma-33ATP] radiometric assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559295(CHEMBL4741075)
Affinity DataIC50:  43nMAssay Description:Inhibition of JAK2 V617F mutant in human SET-2 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559292(CHEMBL4756422)
Affinity DataIC50:  45nMAssay Description:Inhibition of recombinant human TYK2 (875 to end residues) using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of [gamma33P]ATP by ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559281(CHEMBL4748354)
Affinity DataIC50:  47nMAssay Description:Inhibition of human JAK1 (866 to end residues) using GEEPLYWSFPAKKK as substrate after 40 mins by [gamma-33ATP] radiometric assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK3(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559282(CHEMBL4759953)
Affinity DataIC50:  50nMAssay Description:Inhibition of recombinant human JAK3 (781 to end residues) using GGEEEEYFELVKKKK as substrate measured after 40 mins in presence of [gamm33P]ATP by s...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Mus musculus)
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559293(CHEMBL4789273)
Affinity DataIC50:  51nMAssay Description:Inhibition of JAK2 V617F mutant in mouse BaF3 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559295(CHEMBL4741075)
Affinity DataIC50:  52nMAssay Description:Inhibition of recombinant human TYK2 (875 to end residues) using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of [gamma33P]ATP by ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559281(CHEMBL4748354)
Affinity DataIC50:  52nMAssay Description:Inhibition of JAK2 V617F mutant in human SET-2 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK3(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559275(CHEMBL4798378)
Affinity DataIC50:  54nMAssay Description:Inhibition of recombinant human JAK3 (781 to end residues) using GGEEEEYFELVKKKK as substrate measured after 40 mins in presence of [gamm33P]ATP by s...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559275(CHEMBL4798378)
Affinity DataIC50:  56nMAssay Description:Inhibition of recombinant human TYK2 (875 to end residues) using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of [gamma33P]ATP by ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Mus musculus)
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559275(CHEMBL4798378)
Affinity DataIC50:  58nMAssay Description:Inhibition of JAK2 V617F mutant in mouse BaF3 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559282(CHEMBL4759953)
Affinity DataIC50:  60nMAssay Description:Inhibition of human JAK1 (866 to end residues) using GEEPLYWSFPAKKK as substrate after 40 mins by [gamma-33ATP] radiometric assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Mus musculus)
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559295(CHEMBL4741075)
Affinity DataIC50:  61nMAssay Description:Inhibition of JAK2 V617F mutant in mouse BaF3 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559284(CHEMBL4753549)
Affinity DataIC50:  62nMAssay Description:Inhibition of recombinant human FLT3 D835Y mutant (564 to end residues) using EAIYAAPFAKKK as substrate at 40 mins in presence of [gamma-33ATP] by sc...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50505817(CHEMBL4447631)
Affinity DataIC50:  72nMAssay Description:Inhibition of FLT3 ITD mutant in human MOLM13 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559294(CHEMBL4776245)
Affinity DataIC50:  72nMAssay Description:Inhibition of JAK2 V617F mutant in human SET-2 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559275(CHEMBL4798378)
Affinity DataIC50:  73nMAssay Description:Inhibition of JAK2 V617F mutant in human SET-2 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559284(CHEMBL4753549)
Affinity DataIC50:  75nMAssay Description:Inhibition of recombinant human TYK2 (875 to end residues) using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of [gamma33P]ATP by ...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK2(Mus musculus)
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559290(CHEMBL4741668)
Affinity DataIC50:  76nMAssay Description:Inhibition of JAK2 V617F mutant in mouse BaF3 cells assessed as reduction in cell viability incubated for 72 hrs by MTT assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTyrosine-protein kinase JAK3(Homo sapiens (Human))
West China Hospital Of Sichuan University

Curated by ChEMBL
LigandPNGBDBM50559279(CHEMBL4754856)
Affinity DataIC50:  77nMAssay Description:Inhibition of recombinant human JAK3 (781 to end residues) using GGEEEEYFELVKKKK as substrate measured after 40 mins in presence of [gamm33P]ATP by s...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
Displayed 1 to 50 (of 160 total ) | Next | Last >>
Jump to: