Compile Data Set for Download or QSAR
maximum 50k data
Found 45 Enz. Inhib. hit(s) with all data for entry = 50016031
TargetAurora kinase B(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591583(CHEMBL5169760)
Affinity DataIC50:  4nMAssay Description:Inhibition of human Aurora B using AKRRRLSSLRA as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591595(CHEMBL5184642)
Affinity DataIC50:  5nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591605(CHEMBL5185599)
Affinity DataIC50:  5nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591590(CHEMBL5187900)
Affinity DataIC50:  8nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591572(CHEMBL5201640)
Affinity DataIC50:  9nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591598(CHEMBL5192037)
Affinity DataIC50:  10nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591588(CHEMBL5171253)
Affinity DataIC50:  10nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591583(CHEMBL5169760)
Affinity DataIC50:  11nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591593(CHEMBL5187688)
Affinity DataIC50:  11nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591601(CHEMBL5197492)
Affinity DataIC50:  12nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591571(CHEMBL5180366)
Affinity DataIC50:  12nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591589(CHEMBL5204838)
Affinity DataIC50:  12nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591567(CHEMBL5189859)
Affinity DataIC50:  14nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591579(CHEMBL5186349)
Affinity DataIC50:  14nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50172079(CHEMBL3809489)
Affinity DataIC50:  14nMAssay Description:Inhibition of Axl (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591587(CHEMBL5209500)
Affinity DataIC50:  15nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50382425(CHEMBL2022968)
Affinity DataIC50:  15nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591570(CHEMBL5209264)
Affinity DataIC50:  15nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591574(CHEMBL5178768)
Affinity DataIC50:  16nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591591(CHEMBL5199302)
Affinity DataIC50:  16nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591569(CHEMBL5173201)
Affinity DataIC50:  17nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591599(CHEMBL5203409)
Affinity DataIC50:  18nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591594(CHEMBL5205244)
Affinity DataIC50:  22nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591602(CHEMBL5179008)
Affinity DataIC50:  22nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591597(CHEMBL5177979)
Affinity DataIC50:  23nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591600(CHEMBL5187223)
Affinity DataIC50:  25nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591580(CHEMBL5195687)
Affinity DataIC50:  28nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591592(CHEMBL5207577)
Affinity DataIC50:  30nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591584(CHEMBL5175081)
Affinity DataIC50:  30nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591573(CHEMBL5176724)
Affinity DataIC50:  30nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591603(CHEMBL5189203)
Affinity DataIC50:  36nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591577(CHEMBL5173543)
Affinity DataIC50:  46nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591582(CHEMBL5187989)
Affinity DataIC50:  48nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591596(CHEMBL5170873)
Affinity DataIC50:  49nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591568(CHEMBL5204819)
Affinity DataIC50:  49nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591575(CHEMBL5202025)
Affinity DataIC50:  50nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591576(CHEMBL5195675)
Affinity DataIC50:  51nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591586(CHEMBL5183041)
Affinity DataIC50:  100nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591585(CHEMBL5183908)
Affinity DataIC50:  101nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetInsulin-like growth factor 1 receptor(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591583(CHEMBL5169760)
Affinity DataIC50:  103nMAssay Description:Inhibition of human IGF-1R using KKKSPGEYVNIEFG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysi...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591583(CHEMBL5169760)
Affinity DataIC50:  130nMAssay Description:Inhibition of human JAK2 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintil...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591604(CHEMBL5183492)
Affinity DataIC50:  169nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591581(CHEMBL5197239)
Affinity DataIC50:  185nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetALK tyrosine kinase receptor(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591583(CHEMBL5169760)
Affinity DataIC50:  500nMAssay Description:Inhibition of human ALK using KKKSPGEYVNIEFG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University

Curated by ChEMBL
LigandPNGBDBM50591578(CHEMBL5169769)
Affinity DataIC50:  555nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed