Affinity DataIC50: 4nMAssay Description:Inhibition of human Aurora B using AKRRRLSSLRA as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 5nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 5nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 8nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 9nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 10nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 10nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 11nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 11nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 12nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 12nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 12nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 14nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 14nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 14nMAssay Description:Inhibition of Axl (unknown origin)More data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 15nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 15nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 15nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 16nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 16nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 17nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 18nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 22nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 22nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 23nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 25nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 28nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 30nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 30nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 30nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 36nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 46nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 48nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 49nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 49nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 50nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 51nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 100nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 101nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetInsulin-like growth factor 1 receptor(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 103nMAssay Description:Inhibition of human IGF-1R using KKKSPGEYVNIEFG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysi...More data for this Ligand-Target Pair
Affinity DataIC50: 130nMAssay Description:Inhibition of human JAK2 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintil...More data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 169nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 185nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Affinity DataIC50: 500nMAssay Description:Inhibition of human ALK using KKKSPGEYVNIEFG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase receptor UFO(Homo sapiens (Human))
Hunan Normal University
Curated by ChEMBL
Hunan Normal University
Curated by ChEMBL
Affinity DataIC50: 555nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair