Compile Data Set for Download or QSAR
Report error Found 4 Enz. Inhib. hit(s) with all data for entry = 11745
TargetTyrosine-protein kinase JAK1(Human)
Guangzhou Joyo Pharmatech

US Patent
LigandChemical structure of BindingDB Monomer ID 643761BDBM643761(US20240002404, Compound in Embodiment 2 | US123515...)
Affinity DataIC50: 1nMAssay Description:JAK1(h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity an...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/28/2024
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Guangzhou Joyo Pharmatech

US Patent
LigandChemical structure of BindingDB Monomer ID 643761BDBM643761(US20240002404, Compound in Embodiment 2 | US123515...)
Affinity DataIC50: 8nMAssay Description:JAK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM magnesium acetate and [γ-33...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/28/2024
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Guangzhou Joyo Pharmatech

US Patent
LigandChemical structure of BindingDB Monomer ID 643761BDBM643761(US20240002404, Compound in Embodiment 2 | US123515...)
Affinity DataIC50: 15nMAssay Description:TYK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and co...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/28/2024
Entry Details
US Patent

TargetTyrosine-protein kinase JAK3(Human)
Guangzhou Joyo Pharmatech

US Patent
LigandChemical structure of BindingDB Monomer ID 643761BDBM643761(US20240002404, Compound in Embodiment 2 | US123515...)
Affinity DataIC50: 118nMAssay Description:JAK3(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 500 μM GGEEEEYFELVKKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and con...More data for this Ligand-Target Pair
In Depth
Date in BDB:
2/28/2024
Entry Details
US Patent