Compile Data Set for Download or QSAR
maximum 50k data
Found 12 Enz. Inhib. hit(s) with all data for entry = 8196
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Calitor Sciences

US Patent
LigandPNGBDBM236509(US9394281, 8)
Affinity DataIC50:  11nMpH: 7.0 T: 2°CAssay Description:FLT3 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 50 μM EAIYAAPFAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity approx. 500...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetAurora kinase B(Homo sapiens (Human))
Calitor Sciences

US Patent
LigandPNGBDBM236509(US9394281, 8)
Affinity DataIC50:  31nMpH: 7.0 T: 2°CAssay Description:Aurora-B (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 30 μM AKRRRLSSLRA, 10 mM MgAcetate and [γ-33PATP](specific activity approx. 5...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Calitor Sciences

US Patent
LigandPNGBDBM236509(US9394281, 8)
Affinity DataIC50:  31nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetAurora kinase B(Homo sapiens (Human))
Calitor Sciences

US Patent
LigandPNGBDBM236507(US9394281, 5)
Affinity DataIC50:  50nMpH: 7.0 T: 2°CAssay Description:Aurora-B (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 30 μM AKRRRLSSLRA, 10 mM MgAcetate and [γ-33PATP](specific activity approx. 5...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
Calitor Sciences

US Patent
LigandPNGBDBM236509(US9394281, 8)
Affinity DataIC50:  51nMpH: 7.0 T: 2°CAssay Description:Aurora-A (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 200 μM LRRASLG (Kemptide), 10 mM MgAcetate and [γ-33P-ATP](specific activity ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Calitor Sciences

US Patent
LigandPNGBDBM236507(US9394281, 5)
Affinity DataIC50:  57nMpH: 7.0 T: 2°CAssay Description:FLT3 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 50 μM EAIYAAPFAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity approx. 500...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Calitor Sciences

US Patent
LigandPNGBDBM236507(US9394281, 5)
Affinity DataIC50:  61nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
Calitor Sciences

US Patent
LigandPNGBDBM236507(US9394281, 5)
Affinity DataIC50:  68nMpH: 7.0 T: 2°CAssay Description:Aurora-A (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 200 μM LRRASLG (Kemptide), 10 mM MgAcetate and [γ-33P-ATP](specific activity ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Calitor Sciences

US Patent
LigandPNGBDBM236506(US9394281, 3)
Affinity DataIC50:  78nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
Calitor Sciences

US Patent
LigandPNGBDBM236508(US9394281, 7)
Affinity DataIC50:  99nMpH: 7.0 T: 2°CAssay Description:Aurora-A (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 200 μM LRRASLG (Kemptide), 10 mM MgAcetate and [γ-33P-ATP](specific activity ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Calitor Sciences

US Patent
LigandPNGBDBM236505(US9394281, 1)
Affinity DataIC50:  261nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
Calitor Sciences

US Patent
LigandPNGBDBM236505(US9394281, 1)
Affinity DataIC50:  689nMpH: 7.0 T: 2°CAssay Description:JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP] (...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent