Compile Data Set for Download or QSAR
Report error Found 12 Enz. Inhib. hit(s) with all data for entry = 8196
TargetReceptor-type tyrosine-protein kinase FLT3(Human)
Calitor Sciences

US Patent
LigandChemical structure of BindingDB Monomer ID 236509BDBM236509(US9394281, 8)
Affinity DataIC50: 11nMpH: 7.0 T: 2°CAssay Description:FLT3 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 50 μM EAIYAAPFAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity approx. 500...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/3/2017
Entry Details
US Patent

TargetAurora kinase B(Human)
Calitor Sciences

US Patent
LigandChemical structure of BindingDB Monomer ID 236509BDBM236509(US9394281, 8)
Affinity DataIC50: 31nMpH: 7.0 T: 2°CAssay Description:Aurora-B (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 30 μM AKRRRLSSLRA, 10 mM MgAcetate and [γ-33PATP](specific activity approx. 5...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/3/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandChemical structure of BindingDB Monomer ID 236509BDBM236509(US9394281, 8)
Affinity DataIC50: 31nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/3/2017
Entry Details
US Patent

TargetAurora kinase B(Human)
Calitor Sciences

US Patent
LigandChemical structure of BindingDB Monomer ID 236507BDBM236507(US9394281, 5)
Affinity DataIC50: 50nMpH: 7.0 T: 2°CAssay Description:Aurora-B (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 30 μM AKRRRLSSLRA, 10 mM MgAcetate and [γ-33PATP](specific activity approx. 5...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/3/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Calitor Sciences

US Patent
LigandChemical structure of BindingDB Monomer ID 236509BDBM236509(US9394281, 8)
Affinity DataIC50: 51nMpH: 7.0 T: 2°CAssay Description:Aurora-A (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 200 μM LRRASLG (Kemptide), 10 mM MgAcetate and [γ-33P-ATP](specific activity ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/3/2017
Entry Details
US Patent

TargetReceptor-type tyrosine-protein kinase FLT3(Human)
Calitor Sciences

US Patent
LigandChemical structure of BindingDB Monomer ID 236507BDBM236507(US9394281, 5)
Affinity DataIC50: 57nMpH: 7.0 T: 2°CAssay Description:FLT3 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 50 μM EAIYAAPFAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity approx. 500...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/3/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandChemical structure of BindingDB Monomer ID 236507BDBM236507(US9394281, 5)
Affinity DataIC50: 61nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/3/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Calitor Sciences

US Patent
LigandChemical structure of BindingDB Monomer ID 236507BDBM236507(US9394281, 5)
Affinity DataIC50: 68nMpH: 7.0 T: 2°CAssay Description:Aurora-A (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 200 μM LRRASLG (Kemptide), 10 mM MgAcetate and [γ-33P-ATP](specific activity ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/3/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandChemical structure of BindingDB Monomer ID 236506BDBM236506(US9394281, 3)
Affinity DataIC50: 78nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/3/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Calitor Sciences

US Patent
LigandChemical structure of BindingDB Monomer ID 236508BDBM236508(US9394281, 7)
Affinity DataIC50: 99nMpH: 7.0 T: 2°CAssay Description:Aurora-A (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 200 μM LRRASLG (Kemptide), 10 mM MgAcetate and [γ-33P-ATP](specific activity ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/3/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandChemical structure of BindingDB Monomer ID 236505BDBM236505(US9394281, 1)
Affinity DataIC50: 261nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/3/2017
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Calitor Sciences

US Patent
LigandChemical structure of BindingDB Monomer ID 236505BDBM236505(US9394281, 1)
Affinity DataIC50: 689nMpH: 7.0 T: 2°CAssay Description:JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP] (...More data for this Ligand-Target Pair
In Depth
Date in BDB:
7/3/2017
Entry Details
US Patent