Cell Reactant:
D11.15 Fab
Syringe Reactant:
Lysozyme (hen egg)
Meas. Tech.:
ITC
Entry Date.:
12/11/00
ΔG°:
-47.4±1.1 (kJ/mole)
pH:
7.1±n/a
Log10Kb:
7.3
Temperature:
321.45±0.1 (K)
ΔH° :
-114±n/a (kJ/mole)
ΔHobs :
-114±n/a (kJ/mole)
ΔCp :
-1.02±0.15 (kJ/mole)
ΔS° :
-0.207±0.009 (kJ/mole-K)
Citation
 Schwarz, FPTello, DGoldbaum, FAMariuzza, RAPoljak, RJ Thermodynamics of antigen-antibody binding using specific anti-lysozyme antibodies. Eur J Biochem 228:388-94 (1995) [PubMed]
Cell React
Prep. Method:
D11.15 mAb was papan-hydrolyzed and purified
Name:
D11.15 Fab
Synonyms:
n/a
Type:
Antibody
Mol. Mass.:
358.43
Organism:
n/a
Description:
papain-cleaved antigen binding fragment of D11.15
Residue:
3
Sequence:
NA
 
Syringe React
Source:
Sigma Chemical Co.
Name:
Lysozyme (hen egg)
Synonyms:
D1.3 Fv | D1.3 mAb | hen egg lysozyme (HEL) | hen egg lysozyme(HEL)
Type:
Enzyme
Mol. Mass.:
16805.63
Organism:
Mus musculus (mouse)
Description:
P17897
Residue:
148
Sequence:
MKALLTLGLLLLSVTAQAKVYNRCELARILKRNGMDGYRGVKLADWVCLAQHESNYNTRATNYNRGDRSTDYGIFQINSRYWCNDGKTPRSKNACGINCSALLQDDITAAIQCAKRVVRDPQGIRAWVAWRTQCQNRDLSQYIRNCGV