Cell Reactant:
Deoxyribonucleoside 5'-monophosphate N-glycosidase (Rcl)
Syringe Reactant:
BDBM92532
Meas. Tech.:
Enzyme Inhibition
Entry Date.:
10/29/12
ΔG°:
-4.71±0 (kcal/mole)
ΔH° :
-4.62±0.18 (kJ/mole)
ΔS° :
0.29±0 (kJ/mole-K)
Citation
 Dupouy, CZhang, CPadilla, APochet, SKaminski, PA Probing the active site of the deoxynucleotide N-hydrolase Rcl encoded by the rat gene c6orf108. J Biol Chem 285:41806-14 (2010) [PubMed]  Article 
Cell React
Name:
2'-deoxynucleoside 5'-phosphate N-hydrolase 1
Synonyms:
DNPH1_RAT | Deoxyribonucleoside 5'-monophosphate N-glycosidase (Rcl) | Deoxyribonucleoside 5'-monophosphate N-glycosidase (Rcl) D69N | Deoxyribonucleoside 5'-monophosphate N-glycosidase (Rcl) E93Q | Deoxyribonucleoside 5'-monophosphate N-glycosidase (Rcl) S117A | Deoxyribonucleoside 5'-monophosphate N-glycosidase (Rcl) Y13F | Dnph1 | Rcl | c-Myc-responsive protein Rcl
Type:
Enzyme
Mol. Mass.:
17775.23
Organism:
Rattus norvegicus (Rat)
Description:
O35820
Residue:
163
Sequence:
MAASGEQAPCSVYFCGSIRGGREDQALYARIVSRLRRYGKVLTEHVADAELEPLGEEAAGGDQFIHEQDLNWLQQADVVVAEVTQPSLGVGYELGRAVALGKPILCLFRPQSGRVLSAMIRGAADGSRFQVWDYAEGEVETMLDRYFEAYLPQKTASSSHPSA
  
Syringe React
Name:
BDBM92532
Synonyms:
dGMP
Type:
Small molecule
Emp. Form.:
C10H12N5O7P
Mol. Mass.:
345.2064
SMILES:
Nc1nc2n(cnc2c(=O)[nH]1)C1CC(O)C(COP([O-])([O-])=O)O1
Structure:
Search PDB for entries with ligand similarity: