Target
Dimer of Gag-Pol polyprotein [501-599,M537I]
Ligand
BDBM580
Substrate
Chromogenic peptide substrate
Meas. Tech.
Protease Inhibition Assay
pH
4.7±n/a
Temperature
310.15±n/a K
Ki
0.11±0.02 nM
Km
14000±1000 nM
kcat
7.2±0.4 1/sec
Citation
 Clemente, JCHemrajani, RBlum, LEGoodenow, MMDunn, BM Secondary mutations M36I and A71V in the human immunodeficiency virus type 1 protease can provide an advantage for the emergence of the primary mutation D30N. Biochemistry 42:15029-35 (2003) [PubMed]  Article
Target
Name:
Dimer of Gag-Pol polyprotein [501-599,M537I]
Synonyms:
HIV-1 Protease Mutant (M36I)
Type:
Protein Complex
Mol. Mass.:
n/a
Description:
n/a
Components:
This complex has 2 components.
Component 1
Name:
Gag-Pol polyprotein [501-599,M537I]
Synonyms:
HIV-1 Protease Mutant (M36I) chain A | HIV-1 Protease Mutant (M36I) chain B | LAI (M36I)
Type:
Enzyme Subunit
Mol. Mass.:
10777.15
Organism:
Human immunodeficiency virus type 1
Description:
P03367[501-599,M537I]
Residue:
99
Sequence:
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEISLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
  
Component 2
Name:
Gag-Pol polyprotein [501-599,M537I]
Synonyms:
HIV-1 Protease Mutant (M36I) chain A | HIV-1 Protease Mutant (M36I) chain B | LAI (M36I)
Type:
Enzyme Subunit
Mol. Mass.:
10777.15
Organism:
Human immunodeficiency virus type 1
Description:
P03367[501-599,M537I]
Residue:
99
Sequence:
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEISLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
  
Inhibitor
Name:
BDBM580
Synonyms:
(4R)-3-[(2S,3S)-2-hydroxy-3-[(3-hydroxy-2-methylphenyl)formamido]-4-phenylbutanoyl]-5,5-dimethyl-N-[(2-methylphenyl)methyl]-1,3-thiazolidine-4-carboxamide | AG1776 | JE-2147 | KNI-764
Type:
Small organic molecule
Emp. Form.:
n/a
Mol. Mass.:
n/a
SMILES:
n/a
Structure:
Search PDB for entries with ligand similarity:
Substrate
Name:
Chromogenic peptide substrate
Synonyms:
Chromogenic peptide substrate
Type:
Peptide
Mol. Mass.:
1420.11
Organism:
n/a
Description:
n/a
Residue:
13
Sequence:
KARVLNPHEANLG