| Assay Method Information | |
| | Jak2 Kinase Activity Test In Vitro |
| Description: | JAK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa] (SEQ ID NO: 2), 10 mM magnesium acetate, and [γ-33P]-ATP (activity and concentration were determined as required). The reaction was started by adding the Mg/ATP mixture, and after incubation at room temperature for 40 min, the reaction was terminated by adding 0.5% phosphoric acid. Then 10 μL of the reaction product was spotted on a P30 filter pad which was washed three times with 0.425% phosphoric acid and once with methanol within 4 min, dried, and subjected to scintillation counting. |
| Affinity data for this assay | |
|---|---|
| If you find an error in this entry please send us an E-mail | |