Compile Data Set for Download or QSAR
maximum 50k data
Report error Found 67 Enz. Inhib. hit(s) with all data for entry = 50013854
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570310(CHEMBL4876861)
Affinity DataKi:  3nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570295(CHEMBL4854124)
Affinity DataKi:  4nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570294(CHEMBL4855334)
Affinity DataKi:  5nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570317(CHEMBL4863915)
Affinity DataKi:  5nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570314(CHEMBL4847048)
Affinity DataKi:  6nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570316(CHEMBL4864851)
Affinity DataKi:  6nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570301(CHEMBL4868287)
Affinity DataKi:  7nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570308(CHEMBL4863865)
Affinity DataKi:  7.5nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570302(CHEMBL4853628)
Affinity DataKi:  8nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570309(CHEMBL4868954)
Affinity DataKi:  8nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570299(CHEMBL4879020)
Affinity DataKi:  8nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570320(CHEMBL4863852)
Affinity DataKi:  9nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570296(CHEMBL4863124)
Affinity DataKi:  10nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570304(CHEMBL4860925)
Affinity DataKi:  10nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50425005(CHEMBL2312188)
Affinity DataKi:  11nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570297(CHEMBL4847674)
Affinity DataKi:  12nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50425005(CHEMBL2312188)
Affinity DataKi:  12nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570309(CHEMBL4868954)
Affinity DataKi:  14nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570317(CHEMBL4863915)
Affinity DataKi:  16nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570303(CHEMBL4864728)
Affinity DataKi:  19nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570300(CHEMBL4849252)
Affinity DataKi:  20nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570321(CHEMBL4851366)
Affinity DataKi:  21nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570295(CHEMBL4854124)
Affinity DataKi:  22nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570310(CHEMBL4876861)
Affinity DataKi:  22nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570315(CHEMBL4845688)
Affinity DataKi:  25nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570313(CHEMBL4868705)
Affinity DataKi:  32nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570298(CHEMBL4875788)
Affinity DataKi:  34nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570311(CHEMBL4867016)
Affinity DataKi:  40nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570322(CHEMBL4850846)
Affinity DataKi:  43nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570314(CHEMBL4847048)
Affinity DataKi:  44nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570316(CHEMBL4864851)
Affinity DataKi:  45nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570318(CHEMBL4856525)
Affinity DataKi:  47nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570306(CHEMBL4873661)
Affinity DataKi:  49nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570315(CHEMBL4845688)
Affinity DataKi:  52nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570320(CHEMBL4863852)
Affinity DataKi:  55nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570307(CHEMBL4852571)
Affinity DataKi:  62nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM8054(2-Anilino-4-(thiazol-5-yl)pyrimidine deriv. 25 | 4...)
Affinity DataKi:  70nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570298(CHEMBL4875788)
Affinity DataKi:  87nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570301(CHEMBL4868287)
Affinity DataKi:  87nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-H/Cyclin-dependent kinase 7(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570302(CHEMBL4853628)
Affinity DataKi:  89nMAssay Description:Inhibition of recombinant human full length CDK7/Cyclin H using peptide as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scintill...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570312(CHEMBL4851014)
Affinity DataKi:  91nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570305(CHEMBL4876374)
Affinity DataKi:  95nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570294(CHEMBL4855334)
Affinity DataKi:  107nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570308(CHEMBL4863865)
Affinity DataKi:  125nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570311(CHEMBL4867016)
Affinity DataKi:  128nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570319(CHEMBL4871982)
Affinity DataKi:  187nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570321(CHEMBL4851366)
Affinity DataKi:  248nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570313(CHEMBL4868705)
Affinity DataKi:  281nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570296(CHEMBL4863124)
Affinity DataKi:  444nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-H/Cyclin-dependent kinase 7(Homo sapiens (Human))
University of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570299(CHEMBL4879020)
Affinity DataKi:  472nMAssay Description:Inhibition of recombinant human full length CDK7/Cyclin H using peptide as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scintill...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
Displayed 1 to 50 (of 67 total ) | Next | Last >>
Jump to: