Compile Data Set for Download or QSAR
maximum 50k data
Report error Found 69 Enz. Inhib. hit(s) with all data for entry = 50014244
TargetGlycogen synthase kinase-3 alpha(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573930(CHEMBL4856177)
Affinity DataIC50:  0.600nMAssay Description:Inhibition of human GSK3A using YRRAAVPPSPSLSRHSSPHQ(pS)EDEEE as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573929(CHEMBL4848734)
Affinity DataIC50:  0.700nMAssay Description:Inhibition of human CDK2/cyclinA using Histone H1 as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 beta(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573930(CHEMBL4856177)
Affinity DataIC50:  0.800nMAssay Description:Inhibition of human GSK3B using YRRAAVPPSPSLSRHSSPHQ(pS)EDEEE as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-C(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573930(CHEMBL4856177)
Affinity DataIC50:  1nMAssay Description:Inhibition of human CDK8/cyclin C incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573963(CHEMBL4876233)
Affinity DataIC50:  1.20nMAssay Description:Inhibition of human CDK9/cyclin-T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573929(CHEMBL4848734)
Affinity DataIC50:  1.40nMAssay Description:Inhibition of human CDK9/cyclin-T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573930(CHEMBL4856177)
Affinity DataIC50:  1.90nMAssay Description:Inhibition of human CDK9/cyclin-T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573955(CHEMBL4865254)
Affinity DataIC50:  2.10nMAssay Description:Inhibition of human CDK9/cyclin-T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D1(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573930(CHEMBL4856177)
Affinity DataIC50:  2.20nMAssay Description:Inhibition of human CDK4/cyclin-D1 using RB protein as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573950(CHEMBL4860915)
Affinity DataIC50:  2.20nMAssay Description:Inhibition of human CDK9/cyclin-T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573930(CHEMBL4856177)
Affinity DataIC50:  2.20nMAssay Description:Inhibition of human FLT3 using EAIYAAPFAKKK as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50564816(CHEMBL4788347)
Affinity DataIC50:  2.60nMAssay Description:Inhibition of human CDK9/cyclin-T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573956(CHEMBL4847800)
Affinity DataIC50:  2.70nMAssay Description:Inhibition of human CDK9/cyclin-T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50139171(Dinaciclib | MK-7965 | SCH-727965 | US11643396, Ex...)
Affinity DataIC50:  2.70nMAssay Description:Inhibition of human CDK9/cyclin-T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573930(CHEMBL4856177)
Affinity DataIC50:  2.80nMAssay Description:Inhibition of human CDK2/cyclinA using Histone H1 as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573961(CHEMBL4862948)
Affinity DataIC50:  2.80nMAssay Description:Inhibition of human CDK9/cyclin-T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573960(CHEMBL4871619)
Affinity DataIC50:  2.80nMAssay Description:Inhibition of human CDK9/cyclin-T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573957(CHEMBL4852462)
Affinity DataIC50:  3nMAssay Description:Inhibition of human CDK9/cyclin-T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573962(CHEMBL4853882)
Affinity DataIC50:  3.20nMAssay Description:Inhibition of human CDK9/cyclin-T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573949(CHEMBL4859754)
Affinity DataIC50:  3.30nMAssay Description:Inhibition of human CDK9/cyclin-T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573952(CHEMBL4862911)
Affinity DataIC50:  3.30nMAssay Description:Inhibition of human CDK9/cyclin-T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573953(CHEMBL4878634)
Affinity DataIC50:  3.5nMAssay Description:Inhibition of human CDK9/cyclin-T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573945(CHEMBL4849841)
Affinity DataIC50:  3.5nMAssay Description:Inhibition of human CDK9/cyclin-T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573959(CHEMBL4866140)
Affinity DataIC50:  3.60nMAssay Description:Inhibition of human CDK9/cyclin-T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573948(CHEMBL4847535)
Affinity DataIC50:  4.5nMAssay Description:Inhibition of human CDK9/cyclin-T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D1(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573929(CHEMBL4848734)
Affinity DataIC50:  4.90nMAssay Description:Inhibition of human CDK4/cyclin-D1 using RB protein as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573930(CHEMBL4856177)
Affinity DataIC50:  4.90nMAssay Description:Inhibition of human CDK1/cyclinB using Histone H1 as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573958(CHEMBL4857696)
Affinity DataIC50:  5.10nMAssay Description:Inhibition of human CDK9/cyclin-T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573951(CHEMBL4858316)
Affinity DataIC50:  5.70nMAssay Description:Inhibition of human CDK9/cyclin-T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetProtein kinase C alpha type(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573930(CHEMBL4856177)
Affinity DataIC50:  6.30nMAssay Description:Inhibition of human PKCalpha using ERMRPRKRQGSVRRRV as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573941(CHEMBL4848505)
Affinity DataIC50:  6.5nMAssay Description:Inhibition of human CDK9/cyclin-T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573947(CHEMBL4846555)
Affinity DataIC50:  6.70nMAssay Description:Inhibition of human CDK9/cyclin-T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573954(CHEMBL4869627)
Affinity DataIC50:  7.10nMAssay Description:Inhibition of human CDK9/cyclin-T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573929(CHEMBL4848734)
Affinity DataIC50:  8.80nMAssay Description:Inhibition of human CDK1/cyclinB using Histone H1 as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 5 activator 1(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573929(CHEMBL4848734)
Affinity DataIC50:  9nMAssay Description:Inhibition of human CDK5/p25 using histone H1 as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 3/G1/S-specific cyclin-E1(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573929(CHEMBL4848734)
Affinity DataIC50:  11nMAssay Description:Inhibition of human CDK3/cyclinE using Histone H1 as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 5 activator 1(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573930(CHEMBL4856177)
Affinity DataIC50:  15nMAssay Description:Inhibition of human CDK5/p25 using histone H1 as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetNT-3 growth factor receptor(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573930(CHEMBL4856177)
Affinity DataIC50:  17nMAssay Description:Inhibition of human TRKC using poly[Glu:Tyr] (4:1) as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-C(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573929(CHEMBL4848734)
Affinity DataIC50:  20nMAssay Description:Inhibition of human CDK8/cyclin C incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573933(CHEMBL4849424)
Affinity DataIC50:  23nMAssay Description:Inhibition of human CDK9/cyclin-T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 12(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573930(CHEMBL4856177)
Affinity DataIC50:  29nMAssay Description:Inhibition of human CDK12/cyclin-K incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 6/G1/S-specific cyclin-D3(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573929(CHEMBL4848734)
Affinity DataIC50:  31nMAssay Description:Inhibition of human CDK6/cyclin-D3 using RB protein as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573939(CHEMBL4860071)
Affinity DataIC50:  35nMAssay Description:Inhibition of human CDK9/cyclin-T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 6/G1/S-specific cyclin-D3(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573930(CHEMBL4856177)
Affinity DataIC50:  36nMAssay Description:Inhibition of human CDK6/cyclin-D3 using RB protein as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573942(CHEMBL4854509)
Affinity DataIC50:  42nMAssay Description:Inhibition of human CDK9/cyclin-T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 3/G1/S-specific cyclin-E1(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573930(CHEMBL4856177)
Affinity DataIC50:  51nMAssay Description:Inhibition of human CDK3/cyclinE using Histone H1 as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573946(CHEMBL4846827)
Affinity DataIC50:  52nMAssay Description:Inhibition of human CDK9/cyclin-T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-Y/Cyclin-dependent kinase 16(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573929(CHEMBL4848734)
Affinity DataIC50:  56nMAssay Description:Inhibition of human CDK16/cyclin-Y using RB protein as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-Y(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573930(CHEMBL4856177)
Affinity DataIC50:  63nMAssay Description:Inhibition of human CDK14/cyclin-Y using RB protein as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-H/Cyclin-dependent kinase 7(Human)
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50573929(CHEMBL4848734)
Affinity DataIC50:  78nMAssay Description:Inhibition of human CDK7/cyclin-H using MBP as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
Displayed 1 to 50 (of 69 total ) | Next | Last >>
Jump to: