Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 integrase
LigandBDBM50184635
Substrate/Competitorn/a
Meas. Tech.ChEMBL_355503
IC50 3000±n/a nM
Citation Walker, MAJohnson, TMa, ZBanville, JRemillard, RKim, OZhang, YStaab, AWong, HTorri, ASamanta, HLin, ZDeminie, CTerry, BKrystal, MMeanwell, N Triketoacid inhibitors of HIV-integrase: a new chemotype useful for probing the integrase pharmacophore. Bioorg Med Chem Lett16:2920-4 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 integrase
Name:Human immunodeficiency virus type 1 integrase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:32231.48
Organism:Human immunodeficiency virus 1
Description:ChEMBL_90865
Residue:288
Sequence:
FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50184635
NameBDBM50184635
Synonyms:6-(2-fluorophenyl)-2,4,6-trioxohexanoic acid | CHEMBL209827
TypeSmall organic molecule
Emp. Form.C12H9FO5
Mol. Mass.252.1953
SMILESOC(=O)C(=O)CC(=O)CC(=O)c1ccccc1F
Structure
n/a