Reaction Details |
 | Report a problem with these data |
Target | Human immunodeficiency virus type 1 integrase |
---|
Ligand | BDBM50184635 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_355503 |
---|
IC50 | 3000±n/a nM |
---|
Citation | Walker, MA; Johnson, T; Ma, Z; Banville, J; Remillard, R; Kim, O; Zhang, Y; Staab, A; Wong, H; Torri, A; Samanta, H; Lin, Z; Deminie, C; Terry, B; Krystal, M; Meanwell, N Triketoacid inhibitors of HIV-integrase: a new chemotype useful for probing the integrase pharmacophore. Bioorg Med Chem Lett16:2920-4 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Human immunodeficiency virus type 1 integrase |
---|
Name: | Human immunodeficiency virus type 1 integrase |
Synonyms: | n/a |
Type: | PROTEIN |
Mol. Mass.: | 32231.48 |
Organism: | Human immunodeficiency virus 1 |
Description: | ChEMBL_90865 |
Residue: | 288 |
Sequence: | FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED
|
|
|
BDBM50184635 |
---|
Name | BDBM50184635 |
Synonyms: | 6-(2-fluorophenyl)-2,4,6-trioxohexanoic acid | CHEMBL209827 |
Type | Small organic molecule |
Emp. Form. | C12H9FO5 |
Mol. Mass. | 252.1953 |
SMILES | OC(=O)C(=O)CC(=O)CC(=O)c1ccccc1F |
Structure |  |
n/a |
---|