BDBM50602432 CHEMBL5195823

SMILES FC(F)(F)CC(=O)N1CCC2(C1)CCC(CC2)c1cccc2nc(NC(=O)C3CC3)nn12

InChI Key InChIKey=DFYLYUZYTTWHMK-UHFFFAOYSA-N

Data  4 IC50

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 8 hits for monomerid = 50602432   

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602432BDBM50602432(CHEMBL5195823 | US12419873, Compound 5-10)
Affinity DataIC50: 131nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602432BDBM50602432(CHEMBL5195823 | US12419873, Compound 5-10)
Affinity DataIC50: 131nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/6/2026
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602432BDBM50602432(CHEMBL5195823 | US12419873, Compound 5-10)
Affinity DataIC50: 1.53E+3nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602432BDBM50602432(CHEMBL5195823 | US12419873, Compound 5-10)
Affinity DataIC50: 1.53E+3nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/6/2026
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602432BDBM50602432(CHEMBL5195823 | US12419873, Compound 5-10)
Affinity DataIC50: 2.73E+3nMAssay Description:Inhibition of recombinant human JAK2 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in presence of Mg/ATP mixture b...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602432BDBM50602432(CHEMBL5195823 | US12419873, Compound 5-10)
Affinity DataIC50: 2.73E+3nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/6/2026
Entry Details
US Patent

TargetTyrosine-protein kinase JAK3(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602432BDBM50602432(CHEMBL5195823 | US12419873, Compound 5-10)
Affinity DataIC50: 1.00E+4nMAssay Description:Inhibition of recombinant human JAK3 using GGEEEEYFELVKKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK3(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50602432BDBM50602432(CHEMBL5195823 | US12419873, Compound 5-10)
Affinity DataIC50: 1.00E+4nMMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/6/2026
Entry Details
US Patent