BDBM50602439 CHEMBL5172426::US11919896, Compound 1-11

SMILES O=C(Nc1nc2cccc(C3CCC4(CN(C4)C(=O)C4(CC4)C#N)CC3)n2n1)C1CC1

InChI Key InChIKey=RMQNBYVKJXQSLH-UHFFFAOYSA-N

Data  8 IC50

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 12 hits for monomerid = 50602439   

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories Co.

US Patent
LigandPNGBDBM50602439(CHEMBL5172426 | US11919896, Compound 1-11 | US1241...)
Affinity DataIC50: 15nMAssay Description:JAK1:Dilution of JAK2, JAK3 and TYK2: 20 mM 3-(N-morpholine)propanesulfonic acid (MOPS), 1 mM EDTA, 0.01% Brij-35.5% glycerol, 0.1% β-mercaptoet...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2024
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories Co.

US Patent
LigandPNGBDBM50602439(CHEMBL5172426 | US11919896, Compound 1-11 | US1241...)
Affinity DataIC50: 15nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories Co.

US Patent
LigandPNGBDBM50602439(CHEMBL5172426 | US11919896, Compound 1-11 | US1241...)
Affinity DataIC50: 15nMAssay Description:JAK1 (h) was incubated with 20 mm Tris/HCl pH7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mm magnesium acetate and [γ-33P]-ATP (activity and concentr...More data for this Ligand-Target Pair
In Depth
Date in BDB:
1/6/2026
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories Co.

US Patent
LigandPNGBDBM50602439(CHEMBL5172426 | US11919896, Compound 1-11 | US1241...)
Affinity DataIC50: 18nMAssay Description:TYK2:Dilution of JAK2, JAK3 and TYK2: 20 mM 3-(N-morpholine)propanesulfonic acid (MOPS), 1 mM EDTA, 0.01% Brij-35.5% glycerol, 0.1% β-mercaptoet...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2024
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories Co.

US Patent
LigandPNGBDBM50602439(CHEMBL5172426 | US11919896, Compound 1-11 | US1241...)
Affinity DataIC50: 18nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories Co.

US Patent
LigandPNGBDBM50602439(CHEMBL5172426 | US11919896, Compound 1-11 | US1241...)
Affinity DataIC50: 18nMAssay Description:TYK2 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and concentrati...More data for this Ligand-Target Pair
In Depth
Date in BDB:
1/6/2026
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories Co.

US Patent
LigandPNGBDBM50602439(CHEMBL5172426 | US11919896, Compound 1-11 | US1241...)
Affinity DataIC50: 198nMAssay Description:JAK2 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM magnesium acetate and [γ-33P]-ATP (a...More data for this Ligand-Target Pair
In Depth
Date in BDB:
1/6/2026
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories Co.

US Patent
LigandPNGBDBM50602439(CHEMBL5172426 | US11919896, Compound 1-11 | US1241...)
Affinity DataIC50: 198nMAssay Description:JAK2:Dilution of JAK2, JAK3 and TYK2: 20 mM 3-(N-morpholine)propanesulfonic acid (MOPS), 1 mM EDTA, 0.01% Brij-35.5% glycerol, 0.1% β-mercaptoet...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2024
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories Co.

US Patent
LigandPNGBDBM50602439(CHEMBL5172426 | US11919896, Compound 1-11 | US1241...)
Affinity DataIC50: 198nMAssay Description:Inhibition of recombinant human JAK2 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presence of Mg/ATP mixture b...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK3(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602439(CHEMBL5172426 | US11919896, Compound 1-11 | US1241...)
Affinity DataIC50: 1.00E+4nMAssay Description:Inhibition of recombinant human JAK3 using GGEEEEYFELVKKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/24/2023
Entry Details
PubMed
TargetTyrosine-protein kinase JAK3(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602439(CHEMBL5172426 | US11919896, Compound 1-11 | US1241...)
Affinity DataIC50: 1.00E+4nMAssay Description:JAK3:Dilution of JAK2, JAK3 and TYK2: 20 mM 3-(N-morpholine)propanesulfonic acid (MOPS), 1 mM EDTA, 0.01% Brij-35.5% glycerol, 0.1% β-mercaptoet...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2024
Entry Details
US Patent

TargetTyrosine-protein kinase JAK3(Human)
Zhuhai United Laboratories

Curated by ChEMBL
LigandPNGBDBM50602439(CHEMBL5172426 | US11919896, Compound 1-11 | US1241...)
Affinity DataIC50: 1.00E+4nMAssay Description:JAK3 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 500 μM GGEEEEYFELVKKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and concentratio...More data for this Ligand-Target Pair
In Depth
Date in BDB:
1/6/2026
Entry Details
US Patent