BDBM712435 US20250011332, Compound 10
SMILES Cn1ccc(-c2cn3nccc3c(-c3cnn(C4(CC#N)CC5(CCN(C#N)C5)C4)c3)n2)n1
InChI Key InChIKey=ORRNLITYJZKIKF-UHFFFAOYSA-N
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 4 hits for monomerid = 712435
Affinity DataIC50: 30nMAssay Description:TYK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK (SEQ ID NO: 4), 10 mM magnesium acetate, and [γ-33P]-ATP (activity ...More data for this Ligand-Target Pair
Affinity DataIC50: 33nMAssay Description:JAK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC (SEQ ID NO: 2), 10 mM magnesium acetate, and...More data for this Ligand-Target Pair
Affinity DataIC50: 281nMAssay Description:JAK1(h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK (SEQ ID NO: 1), 10 mM magnesium acetate and [γ-33P]-ATP (activi...More data for this Ligand-Target Pair
Affinity DataIC50: 1.00E+4nMAssay Description:JAK3(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 500 μM GGEEEEYFELVKKKK (SEQ ID NO: 3), 10 mM magnesium acetate, and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
