BDBM712442 US20250011332, Compound 18

SMILES Cn1ncc(-c2cn3nccc3c(-c3cnn([C@]4(CC#N)CC5(C[C@@H](C#N)C5)C4)c3)n2)c1N

InChI Key InChIKey=VAMHUIZQIUMVCB-UHFFFAOYSA-N

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 4 hits for monomerid = 712442   

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712442(US20250011332, Compound 18)
Affinity DataIC50: 2nMAssay Description:TYK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK (SEQ ID NO: 4), 10 mM magnesium acetate, and [γ-33P]-ATP (activity ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712442(US20250011332, Compound 18)
Affinity DataIC50: 3nMAssay Description:JAK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa] (SEQ ID NO: 2), 10 mM magnesium acetate, and...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712442(US20250011332, Compound 18)
Affinity DataIC50: 12nMAssay Description:JAK1(h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK (SEQ ID NO: 1), 10 mM magnesium acetate and [γ-33P]-ATP (activi...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK3(Human)
Soter Biopharma

US Patent
LigandPNGBDBM712442(US20250011332, Compound 18)
Affinity DataIC50: 93nMAssay Description:JAK3(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 500 μM GGEEEEYFELVKKKK (SEQ ID NO: 3), 10 mM magnesium acetate, and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent