BDBM394399 US10308614, Example 1::tert-butyl 4-(3-amino-6-(2-hydroxyphenyl)pyridazin-4-yl)piperazine-1-carboxylate

SMILES CC(C)(C)OC(=O)N1CCN(CC1)c1cc(nnc1N)-c1ccccc1O

InChI Key InChIKey=AQTNUGRRZDRZIA-UHFFFAOYSA-N

Data  1 IC50  6 Kd

PDB links: 1 PDB ID matches this monomer.

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 7 hits for monomerid = 394399   

TargetTranscription activator BRG1 [1448-1575](Homo sapiens (Human))
Genentech

US Patent
LigandPNGBDBM394399(US10308614, Example 1 | tert-butyl 4-(3-amino-6-(2...)
Affinity DataIC50:  21.4nMAssay Description:His-BRG1 (A1448-S1575; Swiss Prot P51532; mhhhhhhgslvpr\gsAEKLSPNPP NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNH KYRSLNDLEKDVMLLCQNA...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetTranscription activator BRG1(Homo sapiens (Human))
Goethe University Frankfurt

Curated by ChEMBL
LigandPNGBDBM394399(US10308614, Example 1 | tert-butyl 4-(3-amino-6-(2...)
Affinity DataKd:  36nMAssay Description:Binding affinity to SMARCA4 (unknown origin) by ITC analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProbable global transcription activator SNF2L2(Homo sapiens (Human))
Goethe University Frankfurt

Curated by ChEMBL
LigandPNGBDBM394399(US10308614, Example 1 | tert-butyl 4-(3-amino-6-(2...)
Affinity DataKd:  35nMAssay Description:Binding affinity to SMARCA2 (unknown origin) by ITC analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtein polybromo-1(Homo sapiens (Human))
Goethe University Frankfurt

Curated by ChEMBL
LigandPNGBDBM394399(US10308614, Example 1 | tert-butyl 4-(3-amino-6-(2...)
Affinity DataKd:  3.66E+3nMAssay Description:Binding affinity to polybromo-1 (2) (unknown origin) by ITC analysisMore data for this Ligand-Target Pair
TargetProtein polybromo-1(Homo sapiens (Human))
Goethe University Frankfurt

Curated by ChEMBL
LigandPNGBDBM394399(US10308614, Example 1 | tert-butyl 4-(3-amino-6-(2...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding affinity to polybromo-1 (4) (unknown origin) by ITC analysisMore data for this Ligand-Target Pair
TargetProtein polybromo-1(Homo sapiens (Human))
Goethe University Frankfurt

Curated by ChEMBL
LigandPNGBDBM394399(US10308614, Example 1 | tert-butyl 4-(3-amino-6-(2...)
Affinity DataKd:  1.96E+3nMAssay Description:Binding affinity to polybromo-1 (3) (unknown origin) by ITC analysisMore data for this Ligand-Target Pair
TargetProtein polybromo-1(Homo sapiens (Human))
Goethe University Frankfurt

Curated by ChEMBL
LigandPNGBDBM394399(US10308614, Example 1 | tert-butyl 4-(3-amino-6-(2...)
Affinity DataKd:  13nMAssay Description:Binding affinity to polybromo-1 (5) (unknown origin) by ITC analysisMore data for this Ligand-Target Pair