BDBM394530 (R)-1-(4-(3-amino-6-(2-::US10308614, Example 131

SMILES C[C@@H]1CN(CCN1C(C)=O)c1cc(nnc1N)-c1ccccc1O

InChI Key InChIKey=FHRKRGDHMCCDEO-LLVKDONJSA-N

Data  9 IC50  5 Kd  1 EC50

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 15 hits for monomerid = 394530   

TargetTranscription activator BRG1 [1448-1575](Homo sapiens (Human))
Genentech

US Patent
LigandPNGBDBM394530((R)-1-(4-(3-amino-6-(2- | US10308614, Example 131)
Affinity DataIC50:  34.6nMAssay Description:His-BRG1 (A1448-S1575; Swiss Prot P51532; mhhhhhhgslvpr\gsAEKLSPNPP NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNH KYRSLNDLEKDVMLLCQNA...More data for this Ligand-Target Pair
In DepthDetails US Patent
TargetCytochrome P450 2D6(Homo sapiens (Human))
Constellation, A Morphosys

Curated by ChEMBL
LigandPNGBDBM394530((R)-1-(4-(3-amino-6-(2- | US10308614, Example 131)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of CYP2D6 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetBromodomain-containing protein 4(Homo sapiens (Human))
Constellation, A Morphosys

Curated by ChEMBL
LigandPNGBDBM394530((R)-1-(4-(3-amino-6-(2- | US10308614, Example 131)
Affinity DataIC50:  3.40E+4nMAssay Description:Inhibition of BRD4 bromodomain 1 (unknown origin) by TR-FRET assayMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
Constellation, A Morphosys

Curated by ChEMBL
LigandPNGBDBM394530((R)-1-(4-(3-amino-6-(2- | US10308614, Example 131)
Affinity DataKd:  47nMAssay Description:Binding affinity to His6/FLAG-tagged SMARCA4 (unknown origin) by isothermal titration calorimetric assayMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
Constellation, A Morphosys

Curated by ChEMBL
LigandPNGBDBM394530((R)-1-(4-(3-amino-6-(2- | US10308614, Example 131)
Affinity DataKd:  10nMAssay Description:Binding affinity to human SMARCA4 (A1448 to S1575 residues) expressed in bacterial expression system by bromoscan assayMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetProbable global transcription activator SNF2L2(Homo sapiens (Human))
Constellation, A Morphosys

Curated by ChEMBL
LigandPNGBDBM394530((R)-1-(4-(3-amino-6-(2- | US10308614, Example 131)
Affinity DataKd:  16nMAssay Description:Binding affinity to human SMARCA2 (S1337 to Q1486 residues) expressed in bacterial expression system by bromoscan assayMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetProtein polybromo-1(Homo sapiens (Human))
Constellation, A Morphosys

Curated by ChEMBL
LigandPNGBDBM394530((R)-1-(4-(3-amino-6-(2- | US10308614, Example 131)
Affinity DataKd:  18nMAssay Description:Binding affinity to human PBRM1 bromodomain 5 (S645 to D766 residues) expressed in bacterial expression system by bromoscan assayMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetProtein polybromo-1(Homo sapiens (Human))
Constellation, A Morphosys

Curated by ChEMBL
LigandPNGBDBM394530((R)-1-(4-(3-amino-6-(2- | US10308614, Example 131)
Affinity DataKd:  490nMAssay Description:Binding affinity to human PBRM1 bromodomain 2 (S178 to E291 residues) expressed in bacterial expression system by bromoscan assayMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetProbable global transcription activator SNF2L2(Homo sapiens (Human))
Constellation, A Morphosys

Curated by ChEMBL
LigandPNGBDBM394530((R)-1-(4-(3-amino-6-(2- | US10308614, Example 131)
Affinity DataEC50:  100nMAssay Description:Inhibition of SMARAC2 isoform B (unknown origin) expressed in U2OS cells co-expressed in NLS-ZsGreen incubated for 1 hrs by cellular target engagemen...More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetCytochrome P450 3A4(Homo sapiens (Human))
Constellation, A Morphosys

Curated by ChEMBL
LigandPNGBDBM394530((R)-1-(4-(3-amino-6-(2- | US10308614, Example 131)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of CYP3A4 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetCytochrome P450 2C8(Homo sapiens (Human))
Constellation, A Morphosys

Curated by ChEMBL
LigandPNGBDBM394530((R)-1-(4-(3-amino-6-(2- | US10308614, Example 131)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of CYP2C8 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetCytochrome P450 2C19(Homo sapiens (Human))
Constellation, A Morphosys

Curated by ChEMBL
LigandPNGBDBM394530((R)-1-(4-(3-amino-6-(2- | US10308614, Example 131)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of CYP2C19 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetCytochrome P450 1A2(Homo sapiens (Human))
Constellation, A Morphosys

Curated by ChEMBL
LigandPNGBDBM394530((R)-1-(4-(3-amino-6-(2- | US10308614, Example 131)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of CYP1A2 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetCytochrome P450 2C9(Homo sapiens (Human))
Constellation, A Morphosys

Curated by ChEMBL
LigandPNGBDBM394530((R)-1-(4-(3-amino-6-(2- | US10308614, Example 131)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of CYP2C9 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
Constellation, A Morphosys

Curated by ChEMBL
LigandPNGBDBM394530((R)-1-(4-(3-amino-6-(2- | US10308614, Example 131)
Affinity DataIC50:  35nMAssay Description:Inhibition of His-tagged SMARCA4 (unknown origin) (1448 to 1575 residues) using biotinylated ARTKQTARKSTGG-K(Ac)-APR-K(Ac)-QLAT-K(Ac)-AAR-K(Ac)-SAPGG...More data for this Ligand-Target Pair
In DepthDetails PubMed