BDBM394583 2-(6-amino-5-phenylpyridazin-3-yl)phenol::US10308614, Example 186

SMILES Nc1nnc(cc1-c1ccccc1)-c1ccccc1O

InChI Key InChIKey=SDAWPVIWTVUTCC-UHFFFAOYSA-N

Data  7 IC50  7 Kd  1 EC50

PDB links: 1 PDB ID matches this monomer.

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 15 hits for monomerid = 394583   

TargetTranscription activator BRG1 [1448-1575](Homo sapiens (Human))
Genentech

US Patent
LigandPNGBDBM394583(2-(6-amino-5-phenylpyridazin-3-yl)phenol | US10308...)
Affinity DataIC50:  38.7nMAssay Description:His-BRG1 (A1448-S1575; Swiss Prot P51532; mhhhhhhgslvpr\gsAEKLSPNPP NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNH KYRSLNDLEKDVMLLCQNA...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sidPDB
TargetProbable global transcription activator SNF2L2(Homo sapiens (Human))
Constellation, A Morphosys

Curated by ChEMBL
LigandPNGBDBM394583(2-(6-amino-5-phenylpyridazin-3-yl)phenol | US10308...)
Affinity DataKd:  1.10E+3nMAssay Description:Binding affinity to human MHHHHHHGSLVPRGS-tagged SMARAC2 isoform B L1412P/P1413V/S1414N mutant (S1377 to Q1486 residues) by isothermal titration calo...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sidPDB
In DepthDetails PubMed
TargetProtein polybromo-1 [645-766](Homo sapiens (Human))
Genentech

US Patent
LigandPNGBDBM394583(2-(6-amino-5-phenylpyridazin-3-yl)phenol | US10308...)
Affinity DataIC50:  8.90nMAssay Description:Histidine-Flag-PB1-BD5 Bromodomain645-766 (S645-D766; Swiss Prot Q86U86; mhhhhhhasdykddddkgslvpr\gsSGISPKKSKYMTPMQQKLNEVYEAVKNYTDKRGRRLSAI FLRLPSRSEL...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sidPDB
In DepthDetails US Patent
TargetTranscription activator BRG1(Homo sapiens (Human))
Constellation, A Morphosys

Curated by ChEMBL
LigandPNGBDBM394583(2-(6-amino-5-phenylpyridazin-3-yl)phenol | US10308...)
Affinity DataIC50:  30nMAssay Description:Inhibition of His-tagged SMARCA4 (unknown origin) (1448 to 1575 residues) using biotinylated ARTKQTARKSTGG-K(Ac)-APR-K(Ac)-QLAT-K(Ac)-AAR-K(Ac)-SAPGG...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sidPDB
TargetProbable global transcription activator SNF2L2(Homo sapiens (Human))
Constellation, A Morphosys

Curated by ChEMBL
LigandPNGBDBM394583(2-(6-amino-5-phenylpyridazin-3-yl)phenol | US10308...)
Affinity DataIC50:  37nMAssay Description:Inhibition of SMARCA2 (unknown origin) by TR-FRET assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sidPDB
In DepthDetails PubMed
TargetProtein polybromo-1(Homo sapiens (Human))
Constellation, A Morphosys

Curated by ChEMBL
LigandPNGBDBM394583(2-(6-amino-5-phenylpyridazin-3-yl)phenol | US10308...)
Affinity DataIC50:  8.90nMAssay Description:Inhibition of PBRM1 bromodomain 5 (unknown origin) by TR-FRET assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sidPDB
In DepthDetails PubMed
TargetBromodomain-containing protein 4(Homo sapiens (Human))
Constellation, A Morphosys

Curated by ChEMBL
LigandPNGBDBM394583(2-(6-amino-5-phenylpyridazin-3-yl)phenol | US10308...)
Affinity DataIC50:  2.70E+4nMAssay Description:Inhibition of BRD4 bromodomain 1 (unknown origin) by TR-FRET assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sidPDB
In DepthDetails PubMed
TargetTranscription activator BRG1(Homo sapiens (Human))
Constellation, A Morphosys

Curated by ChEMBL
LigandPNGBDBM394583(2-(6-amino-5-phenylpyridazin-3-yl)phenol | US10308...)
Affinity DataKd:  63nMAssay Description:Binding affinity to His6/FLAG-tagged SMARCA4 (unknown origin) by isothermal titration calorimetric assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sidPDB
TargetTranscription activator BRG1(Homo sapiens (Human))
Constellation, A Morphosys

Curated by ChEMBL
LigandPNGBDBM394583(2-(6-amino-5-phenylpyridazin-3-yl)phenol | US10308...)
Affinity DataKd:  86nMAssay Description:Binding affinity to human SMARCA4 (A1448 to S1575 residues) expressed in bacterial expression system by bromoscan assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sidPDB
TargetProbable global transcription activator SNF2L2(Homo sapiens (Human))
Constellation, A Morphosys

Curated by ChEMBL
LigandPNGBDBM394583(2-(6-amino-5-phenylpyridazin-3-yl)phenol | US10308...)
Affinity DataKd:  71nMAssay Description:Binding affinity to human SMARCA2 (S1337 to Q1486 residues) expressed in bacterial expression system by bromoscan assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sidPDB
In DepthDetails PubMed
TargetProtein polybromo-1(Homo sapiens (Human))
Constellation, A Morphosys

Curated by ChEMBL
LigandPNGBDBM394583(2-(6-amino-5-phenylpyridazin-3-yl)phenol | US10308...)
Affinity DataKd:  69nMAssay Description:Binding affinity to human PBRM1 bromodomain 5 (S645 to D766 residues) expressed in bacterial expression system by bromoscan assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sidPDB
In DepthDetails PubMed
TargetProtein polybromo-1(Homo sapiens (Human))
Constellation, A Morphosys

Curated by ChEMBL
LigandPNGBDBM394583(2-(6-amino-5-phenylpyridazin-3-yl)phenol | US10308...)
Affinity DataKd:  550nMAssay Description:Binding affinity to human PBRM1 bromodomain 2 (S178 to E291 residues) expressed in bacterial expression system by bromoscan assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sidPDB
In DepthDetails PubMed
TargetProbable global transcription activator SNF2L2(Homo sapiens (Human))
Constellation, A Morphosys

Curated by ChEMBL
LigandPNGBDBM394583(2-(6-amino-5-phenylpyridazin-3-yl)phenol | US10308...)
Affinity DataEC50:  300nMAssay Description:Inhibition of SMARAC2 isoform B (unknown origin) expressed in U2OS cells co-expressed in NLS-ZsGreen incubated for 1 hrs by cellular target engagemen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sidPDB
In DepthDetails PubMed
TargetProbable global transcription activator SNF2L2(Homo sapiens (Human))
Constellation, A Morphosys

Curated by ChEMBL
LigandPNGBDBM394583(2-(6-amino-5-phenylpyridazin-3-yl)phenol | US10308...)
Affinity DataKd:  61nMAssay Description:Binding affinity to human MHHHHHHGSLVPRGS-tagged SMARAC2 isoform B (S1377 to Q1486 residues) by isothermal titration calorimetric assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sidPDB
In DepthDetails PubMed
LigandPNGBDBM394583(2-(6-amino-5-phenylpyridazin-3-yl)phenol | US10308...)
Affinity DataIC50:  37.3nMAssay Description:Histidine epitope tagged BRM (Isoform 2) Bromodomain1377-1486 (S1377-Q1486; Swiss Prot P51531-2; mhhhhhhgslvpr\gsSPNPPKLTKQMNAIIDTVINYKDSSGRQLSEVFIQL...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sidPDB