BDBM50238243 CHEMBL4097165
SMILES FC(F)(F)c1ccc2oc(cc2c1)C(=O)NC[C@]1(NC(=O)NC1=O)C1CC1
InChI Key InChIKey=INOYENJSYPDBEC-INIZCTEOSA-N
Data 21 IC50
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 21 hits for monomerid = 50238243
Affinity DataIC50: 9nMAssay Description:Inhibition of human MMP12 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
Affinity DataIC50: 1.60E+4nMAssay Description:Inhibition of human MMP13 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence ...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 63nMAssay Description:Inhibition of human ADAMTS5 using 43-mer-VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG as substrate in presence of Lewis rat plasma measured after 3 hr...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 6nMAssay Description:Inhibition of human ADAMTS4 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assayMore data for this Ligand-Target Pair
Affinity DataIC50: 5.00E+4nMAssay Description:Inhibition of human MMP1 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a...More data for this Ligand-Target Pair
Affinity DataIC50: 5.80E+3nMAssay Description:Inhibition of human MMP2 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a...More data for this Ligand-Target Pair
Affinity DataIC50: 1.70E+4nMAssay Description:Inhibition of human MMP3 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a...More data for this Ligand-Target Pair
Affinity DataIC50: 1.90E+4nMAssay Description:Inhibition of human MMP9 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a...More data for this Ligand-Target Pair
Affinity DataIC50: 7.60E+3nMAssay Description:Inhibition of human MMP14 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence ...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 6nMAssay Description:Inhibition of human ADAMTS4 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assayMore data for this Ligand-Target Pair
Affinity DataIC50: 5.00E+4nMAssay Description:Inhibition of human MMP1 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a...More data for this Ligand-Target Pair
Affinity DataIC50: 5.80E+3nMAssay Description:Inhibition of human MMP2 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a...More data for this Ligand-Target Pair
Affinity DataIC50: 1.70E+4nMAssay Description:Inhibition of human MMP3 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a...More data for this Ligand-Target Pair
Affinity DataIC50: 1.90E+4nMAssay Description:Inhibition of human MMP9 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a...More data for this Ligand-Target Pair
Affinity DataIC50: 7.60E+3nMAssay Description:Inhibition of human MMP14 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence ...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 5nMAssay Description:Inhibition of human ADAMTS5 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assayMore data for this Ligand-Target Pair
Affinity DataIC50: 1.00E+5nMAssay Description:Inhibition of human MMP7 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a...More data for this Ligand-Target Pair
Affinity DataIC50: 1.60E+4nMAssay Description:Inhibition of human MMP13 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence ...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 5nMAssay Description:Inhibition of human ADAMTS5 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assayMore data for this Ligand-Target Pair
Affinity DataIC50: 1.00E+5nMAssay Description:Inhibition of human MMP7 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 63nMAssay Description:Inhibition of human ADAMTS5 using 43-mer-VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG as substrate in presence of Lewis rat plasma measured after 3 hr...More data for this Ligand-Target Pair