BDBM50270298 CHEMBL4075720

SMILES CN1CCN(Cc2ccc(NC(=O)c3n[nH]cc3Nc3ncnc4sccc34)cc2)CC1

InChI Key InChIKey=UDVJBRYBBSVDDS-UHFFFAOYSA-N

Data  26 IC50  3 Kd

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 29 hits for monomerid = 50270298   

TargetALK tyrosine kinase receptor(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataIC50:  94nMAssay Description:Inhibition of human ALK using poly[Glu:Tyr] (4:1) as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins b...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataKd:  0.230nMAssay Description:Binding affinity to human FLT3 ITD/D835V double mutant expressed in bacterial expression system by Kinomescan methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 1(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataIC50:  20nMAssay Description:Inhibition of human FLT1 using poly[Glu:Tyr] (4:1) as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins ...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 6/G1/S-specific cyclin-D1(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataIC50:  4.20nMAssay Description:Inhibition of human CDK6/Cyclin D1 using RB protein as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D1(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataIC50:  3.30nMAssay Description:Inhibition of human CDK4/Cyclin D1 using RB protein as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataIC50:  5.90nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataIC50:  0.438nMAssay Description:Inhibition of human FLT3 using EAIYAAPFAKKK as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins by filt...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataIC50:  39nMAssay Description:Inhibition of human CDK9/Cyclin K using [protein fragment, 39 aa] as substrate preincubated for 20 mins followed by [gamma-33P]-ATP add...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase/G1/S-specific cyclin- 1(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataIC50:  96nMAssay Description:Inhibition of human CDK1/Cyclin E using RB protein as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins ...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataIC50:  13nMAssay Description:Inhibition of human FLT3 Y591-V592 mutant by Hotspot assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataKd:  7nMAssay Description:Binding affinity to human FLT3 D835Y mutant (Q580 to Y969 residues) expressed in bacterial expression system by Kinomescan methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataKd:  1.30nMAssay Description:Binding affinity to human FLT3 ITD/F691L double mutant expressed in bacterial expression system by Kinomescan methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D1(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataIC50: <10nMAssay Description:Inhibition of human CDK4/Cyclin-D1 at 0.123 uM by Hotspot assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataIC50:  0.540nMAssay Description:Inhibition of human FLT3 D835Y mutant by Hotspot assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataIC50:  0.600nMAssay Description:Inhibition of human FLT3 by Hotspot assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 1(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataIC50:  20nMAssay Description:Inhibition of human FLT1 by Hotspot assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataIC50:  35nMAssay Description:Inhibition of human KDR by Hotspot assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 3(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataIC50:  4.5nMAssay Description:Inhibition of human FLT4 by Hotspot assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataIC50: <10nMAssay Description:Inhibition of human CDK2/Cyclin-A at 0.123 uM by Hotspot assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 6/G1/S-specific cyclin-D1(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataIC50: <10nMAssay Description:Inhibition of human CDK6/Cyclin-D1 at 0.123 uM by Hotspot assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase 15(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataIC50: <10nMAssay Description:Inhibition of human ERK7 at 0.123 uM by Hotspot assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataIC50:  1.20nMAssay Description:Inhibition of human FLT3 F594_R595insR mutant by Hotspot assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataIC50:  9.10nMAssay Description:Inhibition of CDK2 (unknown origin) by Hotspot assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 6(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataIC50:  3.30nMAssay Description:Inhibition of CDK6 (unknown origin) by Hotspot assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataIC50:  7.40nMAssay Description:Inhibition of human FLT3 F594_R595insREY mutant by Hotspot assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataIC50:  18nMAssay Description:Inhibition of human FLT3 ITD-NPOS mutant by Hotspot assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataIC50:  1.90nMAssay Description:Inhibition of human FLT3 ITD-W51 mutant by Hotspot assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataIC50:  2.70nMAssay Description:Inhibition of human FLT3 R595_E596 mutant by Hotspot assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetVascular endothelial growth factor receptor 2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataIC50:  35nMAssay Description:Inhibition of human KDR using poly[Glu:Tyr] (4:1) as substrate preincubated for 20 mins followed by [gamma-33P]-ATP addition measure after 120 mins b...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed