BDBM50557742 CHEMBL4752199

SMILES CNc1nc2c(cnn2cc1OC)-c1ccnc(OC)c1

InChI Key InChIKey=PJNMAIKMKRLUIV-UHFFFAOYSA-N

Data  3 IC50

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 3 hits for monomerid = 50557742   

TargetTGF-beta receptor type-2(Homo sapiens (Human))
Japan Tobacco

Curated by ChEMBL
LigandPNGBDBM50557742(CHEMBL4752199)
Affinity DataIC50:  1nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTGF-beta receptor type-1(Homo sapiens (Human))
Japan Tobacco

Curated by ChEMBL
LigandPNGBDBM50557742(CHEMBL4752199)
Affinity DataIC50:  710nMAssay Description:Inhibition of ALK5 (unknown origin) using biotin-labelled KKKVLTQMGSPSIRCSpSVS substrate in presence of [gamma33P] ATP measured after 40 minMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetActivin receptor type-2A(Homo sapiens (Human))
Japan Tobacco

Curated by ChEMBL
LigandPNGBDBM50557742(CHEMBL4752199)
Affinity DataIC50:  310nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed