Compile Data Set for Download or QSAR
Report error Found 154 Enz. Inhib. hit(s) with Target = 'Activin receptor type-2A'
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 6568BDBM6568(PD-173955 | CHEMBL386051 | 6-(2,6-dichlorophenyl)-...)
Affinity DataKd:  10nMAssay Description:Binding constant for ACVR2A kinase domainMore data for this Ligand-Target Pair
In Depth
Date in BDB:
7/19/2012
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 36409BDBM36409(CID24905147 | 2-(4-amino-1-isopropyl-1H-pyrazolo[3...)
Affinity DataKd:  18nMAssay Description:Binding constant for ACVR2A kinase domainMore data for this Ligand-Target Pair
In Depth
Date in BDB:
7/19/2012
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50557751BDBM50557751(CHEMBL4792978)
Affinity DataIC50: 180nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/26/2022
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50557745BDBM50557745(CHEMBL4741913)
Affinity DataIC50: 190nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/26/2022
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 13216BDBM13216(N-(2-Chloro-6-methylphenyl)-2-[[6-[4-(2-hydroxyeth...)
Affinity DataKd:  210nMAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In Depth
Date in BDB:
4/23/2011
Entry Details
PCBioAssay
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 13216BDBM13216(N-(2-Chloro-6-methylphenyl)-2-[[6-[4-(2-hydroxyeth...)
Affinity DataKd:  210nMAssay Description:Binding constant for ACVR2A kinase domainMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/25/2012
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 13216BDBM13216(N-(2-Chloro-6-methylphenyl)-2-[[6-[4-(2-hydroxyeth...)
Affinity DataKd:  210nMAssay Description:Binding constant for ACVR2A kinase domainMore data for this Ligand-Target Pair
In Depth
Date in BDB:
7/19/2012
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50557742BDBM50557742(CHEMBL4752199)
Affinity DataIC50: 310nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/26/2022
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50355496BDBM50355496(CHEMBL1908397)
Affinity DataKd:  320nMAssay Description:Binding constant for ACVR2A kinase domainMore data for this Ligand-Target Pair
In Depth
Date in BDB:
7/19/2012
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50557760BDBM50557760(CHEMBL4749011)
Affinity DataIC50: 530nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/26/2022
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50557743BDBM50557743(CHEMBL4744988)
Affinity DataIC50: 630nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/26/2022
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50557744BDBM50557744(CHEMBL4741185)
Affinity DataIC50: 700nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/26/2022
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50557762BDBM50557762(CHEMBL4747422)
Affinity DataIC50: 800nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/26/2022
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50557763BDBM50557763(CHEMBL4744618)
Affinity DataIC50: 860nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/26/2022
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50621264BDBM50621264(CHEMBL5417444)
Affinity DataIC50: 860nMAssay Description:Inhibition of ACVR2A (unknown origin)More data for this Ligand-Target Pair
Ligand InfoSimilars
In Depth
Date in BDB:
12/17/2024
Entry Details
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50557752BDBM50557752(CHEMBL4763122)
Affinity DataIC50: 960nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/26/2022
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50557747BDBM50557747(CHEMBL4795223)
Affinity DataIC50: 1.10E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/26/2022
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50557739BDBM50557739(CHEMBL4798505)
Affinity DataIC50: 1.20E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/26/2022
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50557741BDBM50557741(CHEMBL4750258)
Affinity DataIC50: 1.20E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/26/2022
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50557749BDBM50557749(CHEMBL4783244)
Affinity DataIC50: 1.30E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/26/2022
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50557746BDBM50557746(CHEMBL4779579)
Affinity DataIC50: 1.30E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/26/2022
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50557756BDBM50557756(CHEMBL4779273)
Affinity DataIC50: 1.90E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/26/2022
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 482158BDBM482158(TAE684 | BDBM50242742)
Affinity DataKd:  2.20E+3nMAssay Description:Binding constant for ACVR2A kinase domainMore data for this Ligand-Target Pair
In Depth
Date in BDB:
7/19/2012
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50557765BDBM50557765(CHEMBL4791414)
Affinity DataIC50: 2.30E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/26/2022
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50557761BDBM50557761(CHEMBL4758580)
Affinity DataIC50: 2.30E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/26/2022
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50466183BDBM50466183(CHEMBL4283638)
Affinity DataIC50: 2.37E+3nMAssay Description:Inhibition of full length GST-tagged human ACVR2A expressed in Baculovirus expression system by LanthaScreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
8/18/2020
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50557764BDBM50557764(CHEMBL4787891)
Affinity DataIC50: 2.40E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/26/2022
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50308060BDBM50308060(CEP-701 | 16-hydroxy-16-(hydroxymethyl)-15-methyl-...)
Affinity DataKd:  2.50E+3nMAssay Description:Binding constant for ACVR2A kinase domainMore data for this Ligand-Target Pair
In Depth
Date in BDB:
7/19/2012
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50308060BDBM50308060(CEP-701 | 16-hydroxy-16-(hydroxymethyl)-15-methyl-...)
Affinity DataKd:  2.50E+3nMAssay Description:Binding affinity to ACVR2AMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/11/2011
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50557754BDBM50557754(CHEMBL4764416)
Affinity DataIC50: 2.70E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/26/2022
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50557755BDBM50557755(CHEMBL4782729)
Affinity DataIC50: 2.90E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/26/2022
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 6866BDBM6866(1-Acyl-1H-[1,2,4]triazole-3,5-diamine Analogue 3b ...)
Affinity DataKd:  2.90E+3nMAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In Depth
Date in BDB:
4/23/2011
Entry Details
PCBioAssay
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50557767BDBM50557767(CHEMBL4764221)
Affinity DataIC50: 2.90E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/26/2022
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 6866BDBM6866(1-Acyl-1H-[1,2,4]triazole-3,5-diamine Analogue 3b ...)
Affinity DataKd:  2.90E+3nMAssay Description:Binding constant for ACVR2A kinase domainMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/25/2012
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50557766BDBM50557766(CHEMBL4751832)
Affinity DataIC50: 3.00E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/26/2022
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50557740BDBM50557740(CHEMBL4777071)
Affinity DataIC50: 3.00E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/26/2022
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50557759BDBM50557759(CHEMBL4763627)
Affinity DataIC50: 3.00E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/26/2022
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 5655BDBM5655(2-(2-chlorophenyl)-5,7-dihydroxy-8-[(3S,4R)-3-hydr...)
Affinity DataKd:  3.10E+3nMAssay Description:Binding constant for ACVR2A kinase domainMore data for this Ligand-Target Pair
In Depth
Date in BDB:
7/19/2012
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50557753BDBM50557753(CHEMBL4748097)
Affinity DataIC50: 3.80E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/26/2022
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50557757BDBM50557757(CHEMBL4792464)
Affinity DataIC50: 4.10E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/26/2022
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50557758BDBM50557758(CHEMBL4749061)
Affinity DataIC50: 5.30E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
In Depth
Date in BDB:
3/26/2022
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 2579BDBM2579(CHEMBL388978 | Staurosporine, 8 | Staurosporin, 4 ...)
Affinity DataKd:  8.90E+3nMAssay Description:Binding constant for ACVR2A kinase domainMore data for this Ligand-Target Pair
In Depth
Date in BDB:
7/19/2012
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50262079BDBM50262079(LDN-193189 | 4-[6-(4-piperazin-1-ylphenyl)pyrazolo...)
Affinity DataIC50: 9.30E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) by LanthaScreen TR-FRET assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
12/13/2024
Entry Details
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 16673BDBM16673(BAY439006 | CHEMBL1336 | BAY 43-9006 | 4-[4-({[4-c...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding affinity to ACVR2AMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/11/2011
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50401152BDBM50401152(CHEMBL2205766)
Affinity DataIC50: 1.00E+4nMAssay Description:Inhibition of ACVR2AMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2013
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50132260BDBM50132260(CHEMBL105442 | US8575391, 341 | CI-1040 | 2-(2-chl...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for ACVR2A kinase domainMore data for this Ligand-Target Pair
In Depth
Date in BDB:
7/19/2012
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50300690BDBM50300690(CHEMBL576982 | N-(5-tert-Butyl-isoxazol-3-yl)-N'-{...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding affinity to ACVR2AMore data for this Ligand-Target Pair
In Depth
Date in BDB:
6/11/2011
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50355501BDBM50355501(RUXOLITINIB PHOSPHATE | INCB-018424 | RUXOLITINIB ...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for ACVR2A kinase domainMore data for this Ligand-Target Pair
In Depth
Date in BDB:
7/19/2012
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50355504BDBM50355504(CHEMBL1908393)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for ACVR2A kinase domainMore data for this Ligand-Target Pair
In Depth
Date in BDB:
7/19/2012
Entry Details Article
PubMed
TargetActivin receptor type-2A(Human)
Ambit Biosciences

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 5931BDBM5931(cid_3025986 | CHEMBL296468 | N-(5-{[(5-tert-butyl-...)
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for ACVR2A kinase domainMore data for this Ligand-Target Pair
In Depth
Date in BDB:
7/19/2012
Entry Details Article
PubMed
Displayed 1 to 50 (of 154 total ) | Next | Last >>
Jump to: