Compile Data Set for Download or QSAR
maximum 50k data
Found 4588 with Last Name = 'shaw' and Initial = 'd'
TargetBifunctional dihydrofolate reductase-thymidylate synthase(Plasmodium falciparum (isolate K1 / Thailand))
Mahidol University

LigandPNGBDBM18793(6,6-dimethyl-1-[3-(2,4,5-trichlorophenoxy)propoxy]...)
Affinity DataKi:  0.0110nM ΔG°:  -62.5kJ/mole IC50:  0.570nMpH: 7.0 T: 2°CAssay Description:The concentration of inhibitor that inhibited 50% of the parasite growth (IC50) was determined from the sigmoidal curve obtained by plotting the perc...More data for this Ligand-Target Pair
TargetBifunctional dihydrofolate reductase-thymidylate synthase(Plasmodium falciparum (isolate K1 / Thailand))
Mahidol University

LigandPNGBDBM18793(6,6-dimethyl-1-[3-(2,4,5-trichlorophenoxy)propoxy]...)
Affinity DataKi:  0.0200nM ΔG°:  -61.1kJ/mole IC50:  2.30nMpH: 7.0 T: 2°CAssay Description:The concentration of inhibitor that inhibited 50% of the parasite growth (IC50) was determined from the sigmoidal curve obtained by plotting the perc...More data for this Ligand-Target Pair
TargetBifunctional dihydrofolate reductase-thymidylate synthase [N51I,C59R,S108N,I164L](Plasmodium falciparum (isolate K1 / Thailand))
Mahidol University

LigandPNGBDBM18793(6,6-dimethyl-1-[3-(2,4,5-trichlorophenoxy)propoxy]...)
Affinity DataKi:  0.0370nM ΔG°:  -59.5kJ/mole IC50:  18nMpH: 7.0 T: 2°CAssay Description:The concentration of inhibitor that inhibited 50% of the parasite growth (IC50) was determined from the sigmoidal curve obtained by plotting the perc...More data for this Ligand-Target Pair
TargetNociceptin receptor(Homo sapiens (Human))
Eli Lilly

Curated by ChEMBL
LigandPNGBDBM50004193(CHEMBL3236476)
Affinity DataKi:  0.0648nMAssay Description:Displacement of [3H]-nociceptin from human recombinant NOP receptor expressed in CHO cells after 60 mins by scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNociceptin receptor(Homo sapiens (Human))
Eli Lilly

Curated by ChEMBL
LigandPNGBDBM50004180(CHEMBL3236474)
Affinity DataKi:  0.0711nMAssay Description:Displacement of [3H]-nociceptin from human recombinant NOP receptor expressed in CHO cells after 60 mins by scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNociceptin receptor(Homo sapiens (Human))
Eli Lilly

Curated by ChEMBL
LigandPNGBDBM50004195(CHEMBL3236478)
Affinity DataKi:  0.0908nMAssay Description:Displacement of [3H]-nociceptin from human recombinant NOP receptor expressed in CHO cells after 60 mins by scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNociceptin receptor(Homo sapiens (Human))
Eli Lilly

Curated by ChEMBL
LigandPNGBDBM50004175(CHEMBL3236486)
Affinity DataKi:  0.0916nMAssay Description:Displacement of [3H]-nociceptin from human recombinant NOP receptor expressed in CHO cells after 60 mins by scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNociceptin receptor(Homo sapiens (Human))
Eli Lilly

Curated by ChEMBL
LigandPNGBDBM50004196(CHEMBL3236479)
Affinity DataKi:  0.0939nMAssay Description:Displacement of [3H]-nociceptin from human recombinant NOP receptor expressed in CHO cells after 60 mins by scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNociceptin receptor(Homo sapiens (Human))
Eli Lilly

Curated by ChEMBL
LigandPNGBDBM50004181(CHEMBL3236475)
Affinity DataKi:  0.0954nMAssay Description:Displacement of [3H]-nociceptin from human recombinant NOP receptor expressed in CHO cells after 60 mins by scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNociceptin receptor(Homo sapiens (Human))
Eli Lilly

Curated by ChEMBL
LigandPNGBDBM50004174(CHEMBL3236485)
Affinity DataKi:  0.0970nMAssay Description:Displacement of [3H]-nociceptin from human recombinant NOP receptor expressed in CHO cells after 60 mins by scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNociceptin receptor(Homo sapiens (Human))
Eli Lilly

Curated by ChEMBL
LigandPNGBDBM50004176(CHEMBL3236487)
Affinity DataKi:  0.105nMAssay Description:Displacement of [3H]-nociceptin from human recombinant NOP receptor expressed in CHO cells after 60 mins by scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNociceptin receptor(Homo sapiens (Human))
Eli Lilly

Curated by ChEMBL
LigandPNGBDBM50004173(CHEMBL3236484)
Affinity DataKi:  0.114nMAssay Description:Displacement of [3H]-nociceptin from human recombinant NOP receptor expressed in CHO cells after 60 mins by scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNociceptin receptor(Homo sapiens (Human))
Eli Lilly

Curated by ChEMBL
LigandPNGBDBM50004194(CHEMBL3236477)
Affinity DataKi:  0.122nMAssay Description:Displacement of [3H]-nociceptin from human recombinant NOP receptor expressed in CHO cells after 60 mins by scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNociceptin receptor(Homo sapiens (Human))
Eli Lilly

Curated by ChEMBL
LigandPNGBDBM50004179(CHEMBL3236473)
Affinity DataKi:  0.139nMAssay Description:Displacement of [3H]-nociceptin from human recombinant NOP receptor expressed in CHO cells after 60 mins by scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNociceptin receptor(Homo sapiens (Human))
Eli Lilly

Curated by ChEMBL
LigandPNGBDBM50004166(CHEMBL3236482)
Affinity DataKi:  0.145nMAssay Description:Displacement of [3H]-nociceptin from human recombinant NOP receptor expressed in CHO cells after 60 mins by scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNociceptin receptor(Homo sapiens (Human))
Eli Lilly

Curated by ChEMBL
LigandPNGBDBM50004144(CHEMBL3236480)
Affinity DataKi:  0.172nMAssay Description:Displacement of [3H]-nociceptin from human recombinant NOP receptor expressed in CHO cells after 60 mins by scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNociceptin receptor(Homo sapiens (Human))
Eli Lilly

Curated by ChEMBL
LigandPNGBDBM50004161(CHEMBL3236481)
Affinity DataKi:  0.176nMAssay Description:Displacement of [3H]-nociceptin from human recombinant NOP receptor expressed in CHO cells after 60 mins by scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNociceptin receptor(Homo sapiens (Human))
Eli Lilly

Curated by ChEMBL
LigandPNGBDBM50004177(CHEMBL3236488)
Affinity DataKi:  0.185nMAssay Description:Displacement of [3H]-nociceptin from human recombinant NOP receptor expressed in CHO cells after 60 mins by scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBifunctional dihydrofolate reductase-thymidylate synthase(Plasmodium falciparum (isolate K1 / Thailand))
Mahidol University

LigandPNGBDBM18512(5-(4-chlorophenyl)-6-ethylpyrimidine-2,4-diamine |...)
Affinity DataKi:  0.200nM ΔG°:  -55.4kJ/mole IC50:  80nMpH: 7.0 T: 2°CAssay Description:The concentration of inhibitor that inhibited 50% of the parasite growth (IC50) was determined from the sigmoidal curve obtained by plotting the perc...More data for this Ligand-Target Pair
TargetNociceptin receptor(Homo sapiens (Human))
Eli Lilly

Curated by ChEMBL
LigandPNGBDBM50004178(Nociceptin | Nociceptin/orphanin FQ | ORPHANIN FQ)
Affinity DataKi:  0.214nMAssay Description:Displacement of [3H]-nociceptin from human recombinant NOP receptor expressed in CHO cells after 60 mins by scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBifunctional dihydrofolate reductase-thymidylate synthase(Plasmodium falciparum (isolate K1 / Thailand))
Mahidol University

LigandPNGBDBM18792(1-(4-chlorophenyl)-6,6-dimethyl-1,6-dihydro-1,3,5-...)
Affinity DataKi:  0.300nM ΔG°:  -54.4kJ/mole IC50:  37nMpH: 7.0 T: 2°CAssay Description:The concentration of inhibitor that inhibited 50% of the parasite growth (IC50) was determined from the sigmoidal curve obtained by plotting the perc...More data for this Ligand-Target Pair
TargetNociceptin receptor(Homo sapiens (Human))
Eli Lilly

Curated by ChEMBL
LigandPNGBDBM50004171(CHEMBL3236483)
Affinity DataKi:  0.371nMAssay Description:Displacement of [3H]-nociceptin from human recombinant NOP receptor expressed in CHO cells after 60 mins by scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMetabotropic glutamate receptor 3(Homo sapiens (Human))
TBA

Curated by ChEMBL
LigandPNGBDBM50244204(CHEMBL4071962)
Affinity DataKi:  0.470nMAssay Description:Displacement of [3H]-LY459477 from recombinant human mGlu3 receptor expressed in HEK cell membranes after 90 mins by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMetabotropic glutamate receptor 3(Homo sapiens (Human))
TBA

Curated by ChEMBL
LigandPNGBDBM50244219(CHEMBL4081453)
Affinity DataKi:  0.927nMAssay Description:Binding affinity against 5-hydroxytryptamine 1A receptor from bovine hippocampus, used [3H]8-OH-DPAT as radioligandMore data for this Ligand-Target Pair
TargetMetabotropic glutamate receptor 3(Homo sapiens (Human))
TBA

Curated by ChEMBL
LigandPNGBDBM50244218(CHEMBL4068189)
Affinity DataKi:  1.80nMAssay Description:Displacement of [3H]-LY459477 from recombinant human mGlu3 receptor expressed in HEK cell membranes after 90 mins by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 2/G1/S-specific cyclin-E1(Homo sapiens (Human))
Cyclacel

LigandPNGBDBM8061(2-Anilino-4-(thiazol-5-yl)pyrimidine deriv. 32 | 4...)
Affinity DataKi:  2nM ΔG°:  -50.5kJ/moleT: 2°CAssay Description:In vitro kinase assay using purified enzyme, was incubated at 30 °C with substrate, and test compounds in the presence of 100 uM ATP/ [gamma-32P...More data for this Ligand-Target Pair
TargetMetabotropic glutamate receptor 3(Homo sapiens (Human))
TBA

Curated by ChEMBL
LigandPNGBDBM50244206(CHEMBL4091203)
Affinity DataKi:  2.10nMAssay Description:Displacement of [3H]-LY459477 from recombinant human mGlu3 receptor expressed in HEK cell membranes after 90 mins by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMetabotropic glutamate receptor 3(Homo sapiens (Human))
TBA

Curated by ChEMBL
LigandPNGBDBM50244202(CHEMBL4091735)
Affinity DataKi:  2.30nMAssay Description:Displacement of [3H]-LY459477 from recombinant human mGlu3 receptor expressed in HEK cell membranes after 90 mins by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMetabotropic glutamate receptor 3(Homo sapiens (Human))
TBA

Curated by ChEMBL
LigandPNGBDBM50244203(CHEMBL4095567)
Affinity DataKi:  2.30nMAssay Description:Displacement of [3H]-LY459477 from recombinant human mGlu3 receptor expressed in HEK cell membranes after 90 mins by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570310(CHEMBL4876861)
Affinity DataKi:  3nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570295(CHEMBL4854124)
Affinity DataKi:  4nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetProstaglandin D2 receptor 2(Homo sapiens (Human))
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50233520(Fevipiprant | NVP-QAW039 | QAW039)
Affinity DataKi:  4nMAssay Description:Displacement of [3H]PGD2 from human DP2 receptor expressed in CHO cell membranes after 60 mins by scintillation proximity assayMore data for this Ligand-Target Pair
TargetProstaglandin D2 receptor 2(Homo sapiens (Human))
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50233524(CHEMBL3981414)
Affinity DataKi:  4nMAssay Description:Displacement of [3H]PGD2 from human DP2 receptor expressed in CHO cell membranes after 60 mins by scintillation proximity assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMetabotropic glutamate receptor 3(Homo sapiens (Human))
TBA

Curated by ChEMBL
LigandPNGBDBM50244221(CHEMBL4063336)
Affinity DataKi:  4.30nMAssay Description:Binding affinity against 5-hydroxytryptamine 1A receptor from bovine hippocampus, used [3H]8-OH-DPAT as radioligandMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMetabotropic glutamate receptor 3(Homo sapiens (Human))
TBA

Curated by ChEMBL
LigandPNGBDBM50244188(CHEMBL4061162)
Affinity DataKi:  4.60nMAssay Description:Displacement of [3H]-LY459477 from recombinant human mGlu3 receptor expressed in HEK cell membranes after 90 mins by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570317(CHEMBL4863915)
Affinity DataKi:  5nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570294(CHEMBL4855334)
Affinity DataKi:  5nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetMetabotropic glutamate receptor 3(Homo sapiens (Human))
TBA

Curated by ChEMBL
LigandPNGBDBM50244207(CHEMBL4090293)
Affinity DataKi:  5.80nMAssay Description:Displacement of [3H]-LY459477 from recombinant human mGlu3 receptor expressed in HEK cell membranes after 90 mins by liquid scintillation countingMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570314(CHEMBL4847048)
Affinity DataKi:  6nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570316(CHEMBL4864851)
Affinity DataKi:  6nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase ATR(Homo sapiens (Human))
Vertex Pharmaceuticals

US Patent
LigandPNGBDBM132734(US8846917, I-1)
Affinity DataKi:  6nM ΔG°:  -46.9kJ/molepH: 7.5 T: 2°CAssay Description:Compounds were screened for their ability to inhibit ATR kinase using a radioactive-phosphate incorporation assay. Assays were carried out in a mixtu...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetProstaglandin D2 receptor 2(Homo sapiens (Human))
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50233523(CHEMBL3931906)
Affinity DataKi:  6nMAssay Description:Displacement of [3H]PGD2 from human DP2 receptor expressed in CHO cell membranes after 60 mins by scintillation proximity assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBifunctional dihydrofolate reductase-thymidylate synthase(Plasmodium falciparum (isolate K1 / Thailand))
Mahidol University

LigandPNGBDBM18792(1-(4-chlorophenyl)-6,6-dimethyl-1,6-dihydro-1,3,5-...)
Affinity DataKi:  6.20nM ΔG°:  -46.8kJ/mole IC50:  2.40E+3nMpH: 7.0 T: 2°CAssay Description:The concentration of inhibitor that inhibited 50% of the parasite growth (IC50) was determined from the sigmoidal curve obtained by plotting the perc...More data for this Ligand-Target Pair
TargetAryl hydrocarbon receptor(Rattus norvegicus)
Cardiff University

Curated by ChEMBL
LigandPNGBDBM50240990(2-(3,4-dimethoxyphenyl)-5-fluorobenzothiazole | 5-...)
Affinity DataKi:  6.80nMAssay Description:Displacement of [3H]tetrachlorodibenzo-p-dioxin from aryl hydrocarbon receptor in CRL:WI rat liver cytosolMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMetabotropic glutamate receptor 3(Homo sapiens (Human))
TBA

Curated by ChEMBL
LigandPNGBDBM50244210(CHEMBL4095995)
Affinity DataKi:  6.80nMAssay Description:Compound was tested for antagonistic activity against D2 receptor from rat striatum, used [3H]raclopride as radioligandMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570301(CHEMBL4868287)
Affinity DataKi:  7nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetProstaglandin D2 receptor 2(Homo sapiens (Human))
Novartis Institutes For Biomedical Research

Curated by ChEMBL
LigandPNGBDBM50233522(CHEMBL3932668)
Affinity DataKi:  7nMAssay Description:Displacement of [3H]PGD2 from human DP2 receptor expressed in CHO cell membranes after 60 mins by scintillation proximity assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570308(CHEMBL4863865)
Affinity DataKi:  7.5nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570302(CHEMBL4853628)
Affinity DataKi:  8nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570309(CHEMBL4868954)
Affinity DataKi:  8nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
Displayed 1 to 50 (of 4588 total ) | Next | Last >>
Jump to: