Affinity DataKi: 1.80nMAssay Description:Displacement of [3H]-TTNPB from RARalpha/RXRalpha (unknown origin) expressed in baculovirus expression system by scintillation proximity assayMore data for this Ligand-Target Pair
Affinity DataKi: 2.80nMAssay Description:Displacement of [3H]-TTNPB from RARalpha/RXRalpha (unknown origin) expressed in baculovirus expression system by scintillation proximity assayMore data for this Ligand-Target Pair
Affinity DataKi: 4.20nMAssay Description:Displacement of [3H]-25-hydroxycholesterol from His-Flag-tagged human RORgammat LBD (309 to 508 residues) expressed in Escherichia coli measured afte...More data for this Ligand-Target Pair
Affinity DataKi: 5.90nMAssay Description:Displacement of [3H]-25-hydroxycholesterol from His-Flag-tagged human RORgammat LBD (309 to 508 residues) expressed in Escherichia coli measured afte...More data for this Ligand-Target Pair
Affinity DataKi: 6.20nMAssay Description:Displacement of [3H]-TTNPB from RARalpha/RXRalpha (unknown origin) expressed in baculovirus expression system by scintillation proximity assayMore data for this Ligand-Target Pair
Affinity DataKi: 7.70nMAssay Description:Displacement of [3H]-TTNPB from RARalpha/RXRalpha (unknown origin) expressed in baculovirus expression system by scintillation proximity assayMore data for this Ligand-Target Pair
Affinity DataKi: 16nMAssay Description:Displacement of [3H]-25-hydroxycholesterol from His-Flag-tagged human RORgammat LBD (309 to 508 residues) expressed in Escherichia coli measured afte...More data for this Ligand-Target Pair
Affinity DataKi: 16nMAssay Description:Displacement of [3H]-25-hydroxycholesterol from His-Flag-tagged human RORgammat LBD (309 to 508 residues) expressed in Escherichia coli measured afte...More data for this Ligand-Target Pair
Affinity DataKi: 16nMAssay Description:Displacement of [3H]-25-hydroxycholesterol from His-Flag-tagged human RORgammat LBD (309 to 508 residues) expressed in Escherichia coli measured afte...More data for this Ligand-Target Pair
Affinity DataKi: 17nMAssay Description:Displacement of [3H]-25-hydroxycholesterol from His-Flag-tagged human RORgammat LBD (309 to 508 residues) expressed in Escherichia coli measured afte...More data for this Ligand-Target Pair
Affinity DataKi: 27nMAssay Description:Displacement of [3H]-25-hydroxycholesterol from His-Flag-tagged human RORgammat LBD (309 to 508 residues) expressed in Escherichia coli measured afte...More data for this Ligand-Target Pair
Affinity DataKi: 87nMAssay Description:Displacement of [3H]-TTNPB from RARalpha/RXRalpha (unknown origin) expressed in baculovirus expression system by scintillation proximity assayMore data for this Ligand-Target Pair
Affinity DataKi: 95nMAssay Description:Displacement of [3H]-25-hydroxycholesterol from His-Flag-tagged human RORgammat LBD (309 to 508 residues) expressed in Escherichia coli measured afte...More data for this Ligand-Target Pair
Affinity DataKi: 139nMAssay Description:Displacement of [3H]-25-hydroxycholesterol from His-Flag-tagged human RORgammat LBD (309 to 508 residues) expressed in Escherichia coli measured afte...More data for this Ligand-Target Pair
Affinity DataKi: 249nMAssay Description:Displacement of [3H]-25-hydroxycholesterol from His-Flag-tagged human RORgammat LBD (309 to 508 residues) expressed in Escherichia coli measured afte...More data for this Ligand-Target Pair
Affinity DataKi: 249nMAssay Description:Displacement of [3H]-25-hydroxycholesterol from His-Flag-tagged human RORgammat LBD (309 to 508 residues) expressed in Escherichia coli measured afte...More data for this Ligand-Target Pair
Affinity DataKi: 278nMAssay Description:Displacement of [3H]-25-hydroxycholesterol from His-Flag-tagged human RORgammat LBD (309 to 508 residues) expressed in Escherichia coli measured afte...More data for this Ligand-Target Pair
Affinity DataKi: 461nMAssay Description:Displacement of [3H]-TTNPB from RARalpha/RXRalpha (unknown origin) expressed in baculovirus expression system by scintillation proximity assayMore data for this Ligand-Target Pair
Affinity DataKi: >1.70E+3nMAssay Description:Displacement of [3H]-TTNPB from RARalpha/RXRalpha (unknown origin) expressed in baculovirus expression system by scintillation proximity assayMore data for this Ligand-Target Pair
Affinity DataKi: >1.70E+3nMAssay Description:Displacement of [3H]-TTNPB from RARalpha/RXRalpha (unknown origin) expressed in baculovirus expression system by scintillation proximity assayMore data for this Ligand-Target Pair
Affinity DataKi: >1.70E+3nMAssay Description:Displacement of [3H]-TTNPB from RARalpha/RXRalpha (unknown origin) expressed in baculovirus expression system by scintillation proximity assayMore data for this Ligand-Target Pair
Affinity DataKi: >1.70E+3nMAssay Description:Displacement of [3H]-TTNPB from RARalpha/RXRalpha (unknown origin) expressed in baculovirus expression system by scintillation proximity assayMore data for this Ligand-Target Pair
Affinity DataKi: >1.70E+3nMAssay Description:Displacement of [3H]-TTNPB from RARalpha/RXRalpha (unknown origin) expressed in baculovirus expression system by scintillation proximity assayMore data for this Ligand-Target Pair
Affinity DataKi: 6.00E+3nMAssay Description:Displacement of [3H]-25-hydroxycholesterol from His-Flag-tagged human RORgammat LBD (309 to 508 residues) expressed in Escherichia coli measured afte...More data for this Ligand-Target Pair
Affinity DataKi: >1.55E+4nMAssay Description:Binding affinity to RORalpha (unknown origin)More data for this Ligand-Target Pair
Affinity DataKi: >2.00E+4nMAssay Description:Binding affinity to RORbeta (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 0.275nMAssay Description:Inhibition of BACE1 in mouse primary cortical neuron assessed as reduction in Amyloid-beta level incubated for 24 hrs by sandwich ELISA assayMore data for this Ligand-Target Pair
Affinity DataIC50: 0.309nMAssay Description:Inhibition of BACE1 in mouse primary cortical neuron assessed as reduction in Amyloid-beta level incubated for 24 hrs by sandwich ELISA assayMore data for this Ligand-Target Pair
Affinity DataIC50: 0.388nMAssay Description:Inhibition of recombinant human BACE2 using (MCA)-S-E-V-N-L-D-A-E-F-R-K(dinitrophenol)-R-R-R-R-NH2 as substrate by FRET assayMore data for this Ligand-Target Pair
Affinity DataIC50: 0.481nMAssay Description:Inhibition of BACE1 in mouse primary cortical neuron assessed as reduction in Amyloid-beta level incubated for 24 hrs by sandwich ELISA assayMore data for this Ligand-Target Pair
Affinity DataIC50: 0.555nMAssay Description:Inhibition of recombinant human BACE2 using (MCA)-S-E-V-N-L-D-A-E-F-R-K(dinitrophenol)-R-R-R-R-NH2 as substrate by FRET assayMore data for this Ligand-Target Pair
Affinity DataIC50: 0.603nMAssay Description:Inhibition of recombinant human BACE1 using (MCA)-S-E-V-N-L-D-A-E-F-R-K(dinitrophenol)-R-R-R-R-NH2 as substrate incubated for 8 hrs by FRET assayMore data for this Ligand-Target Pair
Affinity DataIC50: 0.615nMAssay Description:Inhibition of recombinant human BACE1 using (MCA)-S-E-V-N-L-D-A-E-F-R-K(dinitrophenol)-R-R-R-R-NH2 as substrate incubated for 8 hrs by FRET assayMore data for this Ligand-Target Pair
Affinity DataIC50: 0.780nMAssay Description:Inhibition of recombinant human BACE1 using (MCA)-S-E-V-N-L-D-A-E-F-R-K(dinitrophenol)-R-R-R-R-NH2 as substrate incubated for 8 hrs by FRET assayMore data for this Ligand-Target Pair
Affinity DataIC50: 0.871nMAssay Description:Inhibition of recombinant human BACE2 using (MCA)-S-E-V-N-L-D-A-E-F-R-K(dinitrophenol)-R-R-R-R-NH2 as substrate by FRET assayMore data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of human MMP13 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrsMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of human ADAMTS-5 using [protein fragment, 43 aa] peptide substrate by AlphaScreen assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of human ADAMTS-4 using [protein fragment, 43 aa] peptide substrate by AlphaScreen assayMore data for this Ligand-Target Pair
Affinity DataIC50: 2.30nMAssay Description:Inhibition of recombinant human BACE1 using (MCA)-S-E-V-N-L-D-A-E-F-R-K(dinitrophenol)-R-R-R-R-NH2 as substrate incubated for 8 hrs by FRET assayMore data for this Ligand-Target Pair
Affinity DataIC50: 3nMAssay Description:Inhibition of human MMP3 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrsMore data for this Ligand-Target Pair
Affinity DataIC50: 3.22nMAssay Description:In vitro inhibition assay of cGAS activity: Add a 5 μL mixture containing 10 mM Tris-Cl pH 7.5, 50 mM NaCl, 5 mM MgCl2, 1 mM DTT, 0.01% Triton X...More data for this Ligand-Target Pair
Affinity DataIC50: 3.38nMAssay Description:In vitro inhibition assay of cGAS activity: Add a 5 μL mixture containing 10 mM Tris-Cl pH 7.5, 50 mM NaCl, 5 mM MgCl2, 1 mM DTT, 0.01% Triton X...More data for this Ligand-Target Pair
Affinity DataIC50: 3.56nMAssay Description:In vitro inhibition assay of cGAS activity: Add a 5 μL mixture containing 10 mM Tris-Cl pH 7.5, 50 mM NaCl, 5 mM MgCl2, 1 mM DTT, 0.01% Triton X...More data for this Ligand-Target Pair
Affinity DataIC50: 3.76nMAssay Description:In vitro inhibition assay of cGAS activity: Add a 5 μL mixture containing 10 mM Tris-Cl pH 7.5, 50 mM NaCl, 5 mM MgCl2, 1 mM DTT, 0.01% Triton X...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 4nMAssay Description:Inhibition of human ADAMTS-4 using [protein fragment, 43 aa] peptide substrate by AlphaScreen assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 4nMAssay Description:Inhibition of human ADAMTS-5 using [protein fragment, 43 aa] peptide substrate by AlphaScreen assayMore data for this Ligand-Target Pair
Affinity DataIC50: 4.33nMAssay Description:In vitro inhibition assay of cGAS activity: Add a 5 μL mixture containing 10 mM Tris-Cl pH 7.5, 50 mM NaCl, 5 mM MgCl2, 1 mM DTT, 0.01% Triton X...More data for this Ligand-Target Pair
Affinity DataIC50: 4.74nMAssay Description:In vitro inhibition assay of cGAS activity: Add a 5 μL mixture containing 10 mM Tris-Cl pH 7.5, 50 mM NaCl, 5 mM MgCl2, 1 mM DTT, 0.01% Triton X...More data for this Ligand-Target Pair
Affinity DataIC50: 4.91nMAssay Description:In vitro inhibition assay of cGAS activity: Add a 5 μL mixture containing 10 mM Tris-Cl pH 7.5, 50 mM NaCl, 5 mM MgCl2, 1 mM DTT, 0.01% Triton X...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 5nMAssay Description:Inhibition of human ADAMTS-4 using [protein fragment, 43 aa] peptide substrate by AlphaScreen assayMore data for this Ligand-Target Pair