Compile Data Set for Download or QSAR
maximum 50k data
Found 3338 with Last Name = 'xie' and Initial = 'z'
TargetProthrombin(Homo sapiens (Human))
Hefei University of Technology

Curated by ChEMBL
LigandPNGBDBM50147824(2-[6-Chloro-3-(2,2-difluoro-2-pyridin-2-yl-ethylam...)
Affinity DataKi:  0.00140nMAssay Description:Binding affinity to thrombin (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProthrombin(Homo sapiens (Human))
Hefei University of Technology

Curated by ChEMBL
LigandPNGBDBM50147818((2-[6-CHLORO-3-{[2,2-DIFLUORO-2-(1-OXIDOPYRIDIN-2-...)
Affinity DataKi:  0.00140nMAssay Description:Binding affinity to thrombin (unknown origin)More data for this Ligand-Target Pair
TargetProthrombin(Homo sapiens (Human))
Hefei University of Technology

Curated by ChEMBL
LigandPNGBDBM50147818((2-[6-CHLORO-3-{[2,2-DIFLUORO-2-(1-OXIDOPYRIDIN-2-...)
Affinity DataKi:  0.00140nMAssay Description:Inhibition of thrombin (unknown origin)More data for this Ligand-Target Pair
TargetProthrombin(Homo sapiens (Human))
Hefei University of Technology

Curated by ChEMBL
LigandPNGBDBM50147824(2-[6-Chloro-3-(2,2-difluoro-2-pyridin-2-yl-ethylam...)
Affinity DataKi:  0.00150nMAssay Description:Inhibition of thrombin (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAdenosine deaminase(Homo sapiens (Human))
Hefei University Of Technology

Curated by ChEMBL
LigandPNGBDBM22925((8R)-3-[(2R,4S,5R)-4-hydroxy-5-(hydroxymethyl)oxol...)
Affinity DataKi:  0.00300nMAssay Description:Binding affinity to human erythrocytic ADA assessed as inhibition constant by spectrophotometric analysisMore data for this Ligand-Target Pair
In DepthDetails PubMedDrugBank

TargetAdenosine deaminase(Homo sapiens (Human))
Hefei University Of Technology

Curated by ChEMBL
LigandPNGBDBM50367032(COFORMYCIN)
Affinity DataKi:  0.0100nMAssay Description:Binding affinity to ADA (unknown origin) assessed as inhibition constantMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetProthrombin(Homo sapiens (Human))
Hefei University of Technology

Curated by ChEMBL
LigandPNGBDBM50457929(CHEMBL104951)
Affinity DataKi: <0.0100nMAssay Description:Binding affinity to thrombin (unknown origin)More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetProthrombin(Homo sapiens (Human))
Hefei University of Technology

Curated by ChEMBL
LigandPNGBDBM50457929(CHEMBL104951)
Affinity DataKi: <0.0100nMAssay Description:Inhibition of thrombin (unknown origin)More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetProthrombin(Homo sapiens (Human))
Hefei University of Technology

Curated by ChEMBL
LigandPNGBDBM50457933(CHEMBL327265)
Affinity DataKi: <0.0100nMAssay Description:Binding affinity to thrombin (unknown origin)More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetProthrombin(Homo sapiens (Human))
Hefei University of Technology

Curated by ChEMBL
LigandPNGBDBM50457933(CHEMBL327265)
Affinity DataKi: <0.0100nMAssay Description:Inhibition of thrombin (unknown origin)More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCoagulation factor X(Homo sapiens (Human))
Hefei University of Technology

Curated by ChEMBL
LigandPNGBDBM12751(1-(3-carbamimidoylphenyl)-3-methyl-N-[4-(2-sulfamo...)
Affinity DataKi:  0.0130nMAssay Description:Inhibition of human factor 10a using S-2765 as substrate after 30 mins by spectrophotometric methodMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProthrombin(Homo sapiens (Human))
Hefei University of Technology

Curated by ChEMBL
LigandPNGBDBM50123490(CHEMBL143418 | N-(6-Amino-2-methyl-pyridin-3-ylmet...)
Affinity DataKi:  0.0420nMAssay Description:Inhibition of thrombin (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPlasma kallikrein(Homo sapiens (Human))TBA
LigandPNGBDBM416775(1-(3-(aminomethyl)phenyl)-N-(3-((cyclopropylmethox...)
Affinity DataKi:  0.100nMAssay Description:Inhibition of human plasma kallikrein using H-D-Pro-Phe-Arg-p-nitroaniline as substrate assessed as inhibition constantMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetPlasma kallikrein(Homo sapiens (Human))TBA
LigandPNGBDBM417026((+-)-1-(3-(aminomethyl)phenyl)-N5-(5-((cyclopropyl...)
Affinity DataKi:  0.100nMAssay Description:Inhibition of human plasma kallikrein using H-D-Pro-Phe-Arg-p-nitroaniline as substrate assessed as inhibition constantMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK3(Homo sapiens (Human))
Hefei University Of Technology

Curated by ChEMBL
LigandPNGBDBM50193995(3-((3R,4R)-4-methyl-3-(methyl(7H-pyrrolo[2,3-d]pyr...)
Affinity DataKi:  0.200nMAssay Description:Inhibition of JAK3 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetLethal factor(Bacillus anthracis)
Hefei University Of Technology

Curated by ChEMBL
LigandPNGBDBM50601786(CHEMBL5180162)
Affinity DataKi:  0.270nMAssay Description:Binding affinity to Bacillus anthracis lethal factor assessed as inhibition constantMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetDelta-type/Kappa-type/Mu-type opioid receptor(MOUSE)
University of Minnesota

Curated by ChEMBL
LigandPNGBDBM50474629(CHEMBL415006)
Affinity DataKi:  0.300nMAssay Description:Compound was tested for binding affinity on intact HEK cells using [3H]diprenorphine as radioligand co-expressed with delta and kappa opioid receptor...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase kinase 4(Homo sapiens (Human))
Hefei University Of Technology

Curated by ChEMBL
LigandPNGBDBM50541592(CHEMBL3187788)
Affinity DataKi:  0.400nMAssay Description:Inhibition of NIK (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetProthrombin(Homo sapiens (Human))
Hefei University of Technology

Curated by ChEMBL
LigandPNGBDBM50067796(CHEMBL11157 | L-374087 | N-((6-amino-2-methylpyrid...)
Affinity DataKi:  0.5nMAssay Description:Inhibition of human thrombin assessed as release of p-nitroanilide from chromogenic substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDelta-type/Kappa-type/Mu-type opioid receptor(MOUSE)
University of Minnesota

Curated by ChEMBL
LigandPNGBDBM50474628(CHEMBL386810)
Affinity DataKi:  0.5nMAssay Description:Compound was tested for binding affinity on intact HEK cells using [3H]diprenorphine as radioligand co-expressed with delta and kappa opioid receptor...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetDisintegrin and metalloproteinase domain-containing protein 17(Sus scrofa (pig))
Hefei University Of Technology

Curated by ChEMBL
LigandPNGBDBM26526((2R)-N-hydroxy-2-[(3S)-3-methyl-3-{4-[(2-methylqui...)
Affinity DataKi:  0.560nMAssay Description:Inhibition of porcine TACEMore data for this Ligand-Target Pair
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361648(CHEMBL1940246)
Affinity DataKi:  0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361649(CHEMBL1938415)
Affinity DataKi:  0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Hefei University Of Technology

Curated by ChEMBL
LigandPNGBDBM50193995(3-((3R,4R)-4-methyl-3-(methyl(7H-pyrrolo[2,3-d]pyr...)
Affinity DataKi:  0.700nMAssay Description:Inhibition of JAK1 (unknown origin) assessed as inhibition constantMore data for this Ligand-Target Pair
TargetcGMP-specific 3',5'-cyclic phosphodiesterase(Homo sapiens (Human))
Shandong University

Curated by ChEMBL
LigandPNGBDBM50088373(CHEBI:46295 | Vardenafil | cid_110634)
Affinity DataKi:  0.700nMAssay Description:Inhibition of PDE5 (unknown origin)More data for this Ligand-Target Pair
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361642(CHEMBL1940251)
Affinity DataKi:  0.700nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProthrombin(Homo sapiens (Human))
Hefei University of Technology

Curated by ChEMBL
LigandPNGBDBM50067797(CHEMBL19080 | L-37378 | N-(6-Amino-2-methyl-pyridi...)
Affinity DataKi:  0.800nMAssay Description:Inhibition of human thrombin assessed as release of p-nitroanilide from chromogenic substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361641(CHEMBL1940247)
Affinity DataKi:  0.900nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361652(CHEMBL1940250)
Affinity DataKi:  1nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 4(Homo sapiens (Human))
Hefei University Of Technology

Curated by ChEMBL
LigandPNGBDBM12621(2,4-Diamino-5-ketopyrimidine 39 | 5-[(2,3-difluoro...)
Affinity DataKi:  1nMAssay Description:Inhibition of CDK4 (unknown origin) assessed as inhibition constantMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
Hefei University Of Technology

Curated by ChEMBL
LigandPNGBDBM50193995(3-((3R,4R)-4-methyl-3-(methyl(7H-pyrrolo[2,3-d]pyr...)
Affinity DataKi:  1nMAssay Description:Inhibition of JAK2 (unknown origin)More data for this Ligand-Target Pair
TargetRho-associated protein kinase 1(Homo sapiens (Human))
Hefei University Of Technology

Curated by ChEMBL
LigandPNGBDBM50515430(NETARSUDIL | US11608319, Compound AR-13324)
Affinity DataKi:  1nMAssay Description:Inhibition of ROCK1 (unknown origin)More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetAdenosine deaminase(Homo sapiens (Human))
Hefei University Of Technology

Curated by ChEMBL
LigandPNGBDBM28393((+)-EHNA | (2S,3R)-3-(6-amino-9H-purin-9-yl)nonan-...)
Affinity DataKi:  1nMAssay Description:Binding affinity to ADA (unknown origin) assessed as inhibition constantMore data for this Ligand-Target Pair
TargetRho-associated protein kinase 2(Homo sapiens (Human))
Hefei University Of Technology

Curated by ChEMBL
LigandPNGBDBM50515430(NETARSUDIL | US11608319, Compound AR-13324)
Affinity DataKi:  1nMAssay Description:Inhibition of ROCK2 (unknown origin)More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetDelta-type/Kappa-type/Mu-type opioid receptor(MOUSE)
University of Minnesota

Curated by ChEMBL
LigandPNGBDBM50474624(CHEMBL409172)
Affinity DataKi:  1.10nMAssay Description:Compound was tested for binding affinity on intact HEK cells using [3H]diprenorphine as radioligand singly expressed with delta or kappa receptorMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetProthrombin(Homo sapiens (Human))
Hefei University of Technology

Curated by ChEMBL
LigandPNGBDBM50124086(2-[6-Methyl-2-oxo-3-(2-pyridin-2-yl-ethylamino)-2H...)
Affinity DataKi:  1.20nMAssay Description:Inhibition of human thrombin assessed as release of p-nitroanilide from chromogenic substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361650(CHEMBL1940248)
Affinity DataKi:  1.30nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDelta-type/Kappa-type/Mu-type opioid receptor(MOUSE)
University of Minnesota

Curated by ChEMBL
LigandPNGBDBM50474624(CHEMBL409172)
Affinity DataKi:  1.40nMAssay Description:Compound was tested for binding affinity on intact HEK cells using [3H]diprenorphine as radioligand co-expressed with delta and kappa opioid receptor...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361644(CHEMBL1940253)
Affinity DataKi:  1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361643(CHEMBL1940252)
Affinity DataKi:  1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetcGMP-specific 3',5'-cyclic phosphodiesterase(Homo sapiens (Human))
Shandong University

Curated by ChEMBL
LigandPNGBDBM14390(5-[2-ethoxy-5-(4-methyl-1-piperazinylsulfonyl)phen...)
Affinity DataKi:  1.60nMAssay Description:Inhibition of PDE5 (unknown origin)More data for this Ligand-Target Pair
TargetProthrombin(Homo sapiens (Human))
Hefei University of Technology

Curated by ChEMBL
LigandPNGBDBM50124093(CHEMBL355730 | N-(1H-Indol-5-ylmethyl)-2-[6-methyl...)
Affinity DataKi:  1.60nMAssay Description:Inhibition of human thrombin assessed as release of p-nitroanilide from chromogenic substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRho-associated protein kinase 2(Homo sapiens (Human))
Hefei University Of Technology

Curated by ChEMBL
LigandPNGBDBM50601415(AR-12286 | AR-12286 FREE BASE | Ar-12286 | VEROSUD...)
Affinity DataKi:  2nMAssay Description:Inhibition of ROCK2 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetRho-associated protein kinase 1(Homo sapiens (Human))
Hefei University Of Technology

Curated by ChEMBL
LigandPNGBDBM50601415(AR-12286 | AR-12286 FREE BASE | Ar-12286 | VEROSUD...)
Affinity DataKi:  2nMAssay Description:Inhibition of ROCK1 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetCyclin-dependent kinase 1(Homo sapiens (Human))
Hefei University Of Technology

Curated by ChEMBL
LigandPNGBDBM12621(2,4-Diamino-5-ketopyrimidine 39 | 5-[(2,3-difluoro...)
Affinity DataKi:  2nMAssay Description:Inhibition of CDK1 (unknown origin) assessed as inhibition constantMore data for this Ligand-Target Pair
In DepthDetails PubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361653(CHEMBL1940245)
Affinity DataKi:  2nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProthrombin(Homo sapiens (Human))
Hefei University of Technology

Curated by ChEMBL
LigandPNGBDBM50126302(2-(6-CHLORO-3-{[2,2-DIFLUORO-2-(1-OXIDO-2-PYRIDINY...)
Affinity DataKi:  2.30nMAssay Description:Inhibition of thrombin (unknown origin)More data for this Ligand-Target Pair
TargetProthrombin(Homo sapiens (Human))
Hefei University of Technology

Curated by ChEMBL
LigandPNGBDBM50123481(2-(6-cyano-3-(2,2-difluoro-2-(pyridin-2-yl)ethylam...)
Affinity DataKi:  2.30nMAssay Description:Inhibition of thrombin (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRho-associated protein kinase 2(Homo sapiens (Human))
Hefei University Of Technology

Curated by ChEMBL
LigandPNGBDBM50319005((R)-4-(1-aminoethyl)-N-(1H-pyrrolo[2,3-b]pyridin-4...)
Affinity DataKi:  2.40nMAssay Description:Inhibition of ROCK2 (unknown origin)More data for this Ligand-Target Pair
In DepthDetails PubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361651(CHEMBL1940249)
Affinity DataKi:  2.5nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Displayed 1 to 50 (of 3338 total ) | Next | Last >>
Jump to: