Compile Data Set for Download or QSAR
maximum 50k data
Found 49 with Last Name = 'schroeder' and Initial = 'jc'
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273767(CHEMBL503693)
Affinity DataIC50:  1.40nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273766(CHEMBL526145)
Affinity DataIC50:  2.60nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273766(CHEMBL526145)
Affinity DataIC50:  2.60nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273752(CHEMBL503836 | HAEGTFTSDVSSYLEGQAAKEIFAWLVKGR)
Affinity DataIC50:  2.60nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273752(CHEMBL503836 | HAEGTFTSDVSSYLEGQAAKEIFAWLVKGR)
Affinity DataIC50:  2.60nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273765(CHEMBL525235)
Affinity DataIC50:  3.30nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273765(CHEMBL525235)
Affinity DataIC50:  3.30nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273757(CHEMBL507037)
Affinity DataIC50:  4.5nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273757(CHEMBL507037)
Affinity DataIC50:  4.5nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273758(CHEMBL526516)
Affinity DataIC50:  6.60nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273758(CHEMBL526516)
Affinity DataIC50:  6.60nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273759(CHEMBL507591)
Affinity DataIC50:  15nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273760(CHEMBL503491)
Affinity DataIC50:  17nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273760(CHEMBL503491)
Affinity DataIC50:  17nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273753(CHEMBL524864)
Affinity DataIC50:  110nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273755(CHEMBL525582)
Affinity DataIC50:  210nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273755(CHEMBL525582)
Affinity DataIC50:  210nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273756(CHEMBL525424)
Affinity DataIC50:  229nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273754(CHEMBL526484)
Affinity DataIC50:  440nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273754(CHEMBL526484)
Affinity DataIC50:  440nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273762(CHEMBL525405)
Affinity DataIC50:  1.20E+3nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273762(CHEMBL525405)
Affinity DataIC50:  1.20E+3nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273764(CHEMBL500483)
Affinity DataIC50:  1.60E+3nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273764(CHEMBL500483)
Affinity DataIC50:  1.60E+3nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273761(CHEMBL502036)
Affinity DataIC50:  3.00E+3nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273761(CHEMBL502036)
Affinity DataIC50:  3.00E+3nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273763(CHEMBL525051)
Affinity DataIC50:  9.20E+3nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273763(CHEMBL525051)
Affinity DataIC50:  9.20E+3nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273770(CHEMBL500753)
Affinity DataEC50:  1.40nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273757(CHEMBL507037)
Affinity DataEC50:  0.00759nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273754(CHEMBL526484)
Affinity DataEC50:  23nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273758(CHEMBL526516)
Affinity DataEC50:  0.0120nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273755(CHEMBL525582)
Affinity DataEC50:  8.30nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273752(CHEMBL503836 | HAEGTFTSDVSSYLEGQAAKEIFAWLVKGR)
Affinity DataEC50:  0.00360nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273756(CHEMBL525424)
Affinity DataEC50:  15nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273753(CHEMBL524864)
Affinity DataEC50:  0.380nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273769(CHEMBL524660)
Affinity DataEC50:  19nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273768(CHEMBL524305)
Affinity DataEC50:  0.00479nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273767(CHEMBL503693)
Affinity DataEC50:  0.00209nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273766(CHEMBL526145)
Affinity DataEC50:  0.00282nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273753(CHEMBL524864)
Affinity DataEC50:  0.380nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273764(CHEMBL500483)
Affinity DataEC50:  0.123nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273763(CHEMBL525051)
Affinity DataEC50:  1.10nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273762(CHEMBL525405)
Affinity DataEC50:  0.102nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273761(CHEMBL502036)
Affinity DataEC50:  0.363nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273760(CHEMBL503491)
Affinity DataEC50:  0.00380nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273771(CHEMBL526164)
Affinity DataEC50:  0.00331nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273759(CHEMBL507591)
Affinity DataEC50:  0.00199nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273765(CHEMBL525235)
Affinity DataEC50:  0.00288nMAssay Description:Activation of human GLP1R expressed in HEK293 cells assessed as effect on cAMP responsive element promoter driven luciferase expressionMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed